GlyCosmos Portal

GlyTouCan

Glycan Structure Repository

GlyComb

Glycoconjugate Repository

GlycoPOST

Glycomics MS raw data Repository

UniCarb-DR

Glycomics MS Repository for glycan annotations from GlycoWorkbench

LM-GlycoRepo

Repository for lectin-assisted multimodality data

All Resources

Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms

Other Information

Release Statistics Download

Tools

Glycan Converters

LM-GlycomeAtlas

Search Tools

Cross Search Glycan Search Publication Search Programmatic Access

Guidelines

MIRAGE

Glucose-6-phosphatase catalytic subunit 1

Summary

UniProt ID: Q29RU6
Gene Symbol: G6PC1 G6PC
Gene ID: 538710
Organism: Bos taurus (domestic cattle)

External Links

PubChem: Q29RU6
Re-Glyco: Q29RU6

Annotation

Keyword: Endoplasmic reticulum Gluconeogenesis Glycoprotein Hydrolase Reference proteome Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
glycogen catabolic process
gluconeogenesis	IBA	GO_REF
gluconeogenesis	IEA	GO_REF GO_REF GO_REF
triglyceride metabolic process
steroid metabolic process

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

generation of precursor metabolites and energy [inference]

energy derivation by oxidation of organic compounds [inference]

energy reserve metabolic process [inference]

glycogen metabolic process [inference]

glycogen catabolic process

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

glucose 6-phosphate metabolic process

organophosphate metabolic process [inference]

glucose 6-phosphate metabolic process

catabolic process [inference]

macromolecule catabolic process [inference]

polysaccharide catabolic process [inference]

glucan catabolic process [inference]

glycogen catabolic process

carbohydrate catabolic process [inference]

polysaccharide catabolic process [inference]

glucan catabolic process [inference]

glycogen catabolic process

biosynthetic process [inference]

carbohydrate biosynthetic process [inference]

monosaccharide biosynthetic process [inference]

hexose biosynthetic process [inference]

gluconeogenesis

small molecule biosynthetic process [inference]

monosaccharide biosynthetic process [inference]

hexose biosynthetic process [inference]

gluconeogenesis

macromolecule metabolic process [inference]

polysaccharide metabolic process [inference]

polysaccharide catabolic process [inference]

glucan catabolic process [inference]

glycogen catabolic process

glucan metabolic process [inference]

glycogen metabolic process [inference]

glycogen catabolic process

glucan catabolic process [inference]

glycogen catabolic process

macromolecule catabolic process [inference]

polysaccharide catabolic process [inference]

glucan catabolic process [inference]

glycogen catabolic process

primary metabolic process [inference]

carbohydrate metabolic process [inference]

polysaccharide metabolic process [inference]

polysaccharide catabolic process [inference]

glucan catabolic process [inference]

glycogen catabolic process

glucan metabolic process [inference]

glycogen metabolic process [inference]

glycogen catabolic process

glucan catabolic process [inference]

glycogen catabolic process

monosaccharide metabolic process [inference]

hexose metabolic process [inference]

glucose metabolic process [inference]

gluconeogenesis

hexose biosynthetic process [inference]

gluconeogenesis

monosaccharide biosynthetic process [inference]

hexose biosynthetic process [inference]

gluconeogenesis

carbohydrate biosynthetic process [inference]

monosaccharide biosynthetic process [inference]

hexose biosynthetic process [inference]

gluconeogenesis

carbohydrate catabolic process [inference]

polysaccharide catabolic process [inference]

glucan catabolic process [inference]

glycogen catabolic process

lipid metabolic process [inference]

neutral lipid metabolic process [inference]

acylglycerol metabolic process [inference]

triglyceride metabolic process

steroid metabolic process

glycerolipid metabolic process [inference]

acylglycerol metabolic process [inference]

triglyceride metabolic process

small molecule metabolic process [inference]

monosaccharide metabolic process [inference]

hexose metabolic process [inference]

glucose metabolic process [inference]

gluconeogenesis

hexose biosynthetic process [inference]

gluconeogenesis

monosaccharide biosynthetic process [inference]

hexose biosynthetic process [inference]

gluconeogenesis

small molecule biosynthetic process [inference]

monosaccharide biosynthetic process [inference]

hexose biosynthetic process [inference]

gluconeogenesis

urate metabolic process

purine-containing compound metabolic process [inference]

urate metabolic process

carbohydrate derivative metabolic process [inference]

glucose 6-phosphate metabolic process

multicellular organismal process [inference]

multicellular organism growth

growth [inference]

developmental growth [inference]

multicellular organism growth

homeostatic process [inference]

chemical homeostasis [inference]

carbohydrate homeostasis [inference]

glucose homeostasis

lipid homeostasis [inference]

sterol homeostasis [inference]

cholesterol homeostasis

response to stimulus [inference]

response to stress [inference]

response to caloric restriction

response to nutrient levels [inference]

response to caloric restriction

localization [inference]

establishment of localization [inference]

transport [inference]

organic anion transport [inference]

glucose-6-phosphate transport

organophosphate ester transport [inference]

hexose phosphate transport [inference]

glucose-6-phosphate transport

carbohydrate derivative transport [inference]

hexose phosphate transport [inference]

glucose-6-phosphate transport

biological regulation [inference]

regulation of biological process [inference]

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression

Displaying **all 4** entries
GO Term	Evidence Code	Reference
endoplasmic reticulum membrane	ISS	GO_REF
endoplasmic reticulum membrane	IEA	GO_REF
membrane	IBA	GO_REF
membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

organelle membrane [inference]

endoplasmic reticulum membrane

Displaying **all 5** entries
GO Term	Evidence Code	Reference
glucose-6-phosphatase activity	ISS	GO_REF
glucose-6-phosphatase activity	IBA	GO_REF
glucose-6-phosphatase activity	IEA	GO_REF GO_REF GO_REF GO_REF GO_REF
phosphotransferase activity, alcohol group as acceptor	IEA	GO_REF
phosphate ion binding	IEA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

transferase activity, transferring phosphorus-containing groups [inference]

phosphotransferase activity, alcohol group as acceptor

hydrolase activity [inference]

hydrolase activity, acting on ester bonds [inference]

phosphoric ester hydrolase activity [inference]

phosphatase activity [inference]

carbohydrate phosphatase activity [inference]

sugar-phosphatase activity [inference]

sugar-terminal-phosphatase activity [inference]

glucose-6-phosphatase activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

phosphate ion binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MEKGMNVLHDFGIQSTHYLQVNYQNSQDWFILVSVIADLRNAFYVLFPIWFHLREAVGIKLLWVAVIGDWLNLVFKWILFGQRPYWWVLDTDYYSNTSAPLIKQFPVTCETGPGSPSGHAMGTAGVYYVMVTSTLSIFRGKKKPTYRFRCLNVMLWLGFWVVQLNVCLSRIYLAAHFPHQVVAGVLSGIAVAETFRHIQSIYNASLKKYFLITCFLFSFAIGFYLLLKWLGVDLLWTLEKAKRRCERPEWVHIDTTPFASLLKNLGTLFGLGLALNSSMYRESCKGKLSKWFPFRLSCIVASLVLLHLFDSLKPPSQIELIFYVLSFCKSAAVPLASVSLIPYCLAWVLGQPNKKTV

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
96	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Gluconeogenesis	Bos taurus

About Release Notes Help Feedback

Click here to visit the beta site.

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026