GlyCosmos Portal

Submissions

Transcriptional coactivator YAP1

Summary

UniProt ID: Q2EJA0
Gene Symbol: Yap Yap1 Yap65
Gene ID: 363014
Organism: Rattus norvegicus (Norway rat)

External Links

GlyGen: Q2EJA0
PubChem: Q2EJA0
Re-Glyco: Q2EJA0

Annotation

Keyword: Activator Alternative splicing Cell membrane Coiled coil Cytoplasm Nucleus Phosphoprotein Proto-oncogene Reference proteome Repeat Repressor Tight junction Transcription regulation Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 78 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
negative regulation of transcription by RNA polymerase II	ISS	GO_REF
negative regulation of transcription by RNA polymerase II	ISO	GO_REF
cell morphogenesis	ISO	GO_REF
vasculogenesis	ISO	GO_REF
blastocyst development

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

cytokine-mediated signaling pathway [inference]

interleukin-6-mediated signaling pathway

intracellular signal transduction [inference]

metabolic process [inference]

generation of precursor metabolites and energy [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

purine ribonucleotide metabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ATP metabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

pyridine nucleotide catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ATP metabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

nicotinamide nucleotide metabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

nucleoside diphosphate metabolic process [inference]

nucleoside diphosphate catabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

purine nucleoside diphosphate metabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate metabolic process [inference]

ATP metabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

nucleoside phosphate catabolic process [inference]

nucleoside diphosphate catabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

pyridine nucleotide catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ATP metabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

organophosphate metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

purine ribonucleotide metabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ATP metabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

pyridine nucleotide catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ATP metabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

nicotinamide nucleotide metabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

nucleoside diphosphate metabolic process [inference]

nucleoside diphosphate catabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

purine nucleoside diphosphate metabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate metabolic process [inference]

ATP metabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

nucleoside phosphate catabolic process [inference]

nucleoside diphosphate catabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

pyridine nucleotide catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ATP metabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

organophosphate catabolic process [inference]

nucleoside phosphate catabolic process [inference]

nucleoside diphosphate catabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

pyridine nucleotide catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

catabolic process [inference]

carbohydrate catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

monosaccharide catabolic process [inference]

hexose catabolic process [inference]

glucose catabolic process [inference]

glucose catabolic process to pyruvate [inference]

canonical glycolysis

nucleobase-containing compound catabolic process [inference]

nucleoside phosphate catabolic process [inference]

nucleoside diphosphate catabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

pyridine nucleotide catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

small molecule catabolic process [inference]

monosaccharide catabolic process [inference]

hexose catabolic process [inference]

glucose catabolic process [inference]

glucose catabolic process to pyruvate [inference]

canonical glycolysis

organophosphate catabolic process [inference]

nucleoside phosphate catabolic process [inference]

nucleoside diphosphate catabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

pyridine nucleotide catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

purine-containing compound catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

pyridine-containing compound catabolic process [inference]

pyridine nucleotide catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

carbohydrate derivative catabolic process [inference]

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

primary metabolic process [inference]

carbohydrate metabolic process [inference]

monosaccharide metabolic process [inference]

hexose metabolic process [inference]

glucose metabolic process [inference]

glucose catabolic process [inference]

glucose catabolic process to pyruvate [inference]

canonical glycolysis

hexose catabolic process [inference]

glucose catabolic process [inference]

glucose catabolic process to pyruvate [inference]

canonical glycolysis

monosaccharide catabolic process [inference]

hexose catabolic process [inference]

glucose catabolic process [inference]

glucose catabolic process to pyruvate [inference]

canonical glycolysis

carbohydrate catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

monosaccharide catabolic process [inference]

hexose catabolic process [inference]

glucose catabolic process [inference]

glucose catabolic process to pyruvate [inference]

canonical glycolysis

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound catabolic process [inference]

nucleoside phosphate catabolic process [inference]

nucleoside diphosphate catabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

pyridine nucleotide catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

purine ribonucleotide metabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ATP metabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

pyridine nucleotide catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ATP metabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

nicotinamide nucleotide metabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

nucleoside diphosphate metabolic process [inference]

nucleoside diphosphate catabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

purine nucleoside diphosphate metabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate metabolic process [inference]

ATP metabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

nucleoside phosphate catabolic process [inference]

nucleoside diphosphate catabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

pyridine nucleotide catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

small molecule metabolic process [inference]

monosaccharide metabolic process [inference]

hexose metabolic process [inference]

glucose metabolic process [inference]

glucose catabolic process [inference]

glucose catabolic process to pyruvate [inference]

canonical glycolysis

hexose catabolic process [inference]

glucose catabolic process [inference]

glucose catabolic process to pyruvate [inference]

canonical glycolysis

monosaccharide catabolic process [inference]

hexose catabolic process [inference]

glucose catabolic process [inference]

glucose catabolic process to pyruvate [inference]

canonical glycolysis

organic acid metabolic process [inference]

oxoacid metabolic process [inference]

carboxylic acid metabolic process [inference]

monocarboxylic acid metabolic process [inference]

pyruvate metabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

glucose catabolic process to pyruvate [inference]

canonical glycolysis

small molecule catabolic process [inference]

monosaccharide catabolic process [inference]

hexose catabolic process [inference]

glucose catabolic process [inference]

glucose catabolic process to pyruvate [inference]

canonical glycolysis

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

purine ribonucleotide metabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ATP metabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

pyridine nucleotide catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ATP metabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

nicotinamide nucleotide metabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

nucleoside diphosphate metabolic process [inference]

nucleoside diphosphate catabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

purine nucleoside diphosphate metabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate metabolic process [inference]

ATP metabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

nucleoside phosphate catabolic process [inference]

nucleoside diphosphate catabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

pyridine nucleotide catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

purine-containing compound metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

purine ribonucleotide metabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ATP metabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

purine-containing compound catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

pyridine-containing compound metabolic process [inference]

nicotinamide nucleotide metabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

pyridine-containing compound catabolic process [inference]

pyridine nucleotide catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

carbohydrate derivative metabolic process [inference]

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ATP metabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

carbohydrate derivative catabolic process [inference]

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process [inference]

glycolytic process through fructose-6-phosphate [inference]

glycolytic process through glucose-6-phosphate [inference]

canonical glycolysis

cell population proliferation [inference]

epithelial cell proliferation

cellular developmental process [inference]

cell differentiation [inference]

epithelial cell differentiation [inference]

columnar/cuboidal epithelial cell differentiation [inference]

glandular epithelial cell differentiation

intestinal epithelial cell differentiation

enterocyte differentiation

epidermal cell differentiation [inference]

keratinocyte differentiation

lung epithelial cell differentiation

lung cell differentiation [inference]

lung epithelial cell differentiation

cell development [inference]

epithelial cell development [inference]

columnar/cuboidal epithelial cell development [inference]

intestinal epithelial cell development

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to DNA damage stimulus

signal transduction in response to DNA damage

cellular response to chemical stimulus [inference]

cellular response to lipid [inference]

cellular response to retinoic acid

cellular response to oxygen-containing compound [inference]

cellular response to retinoic acid

cellular response to environmental stimulus [inference]

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to ionizing radiation [inference]

cellular response to gamma radiation

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cellular component assembly [inference]

protein-containing complex assembly

protein-containing complex organization [inference]

protein-containing complex assembly

multicellular organismal process [inference]

system process [inference]

circulatory system process [inference]

heart process

stem cell population maintenance [inference]

somatic stem cell population maintenance

organ growth

multicellular organismal-level homeostasis [inference]

anatomical structure homeostasis [inference]

tissue homeostasis

developmental process [inference]

anatomical structure morphogenesis [inference]

cell morphogenesis

tube morphogenesis [inference]

epithelial tube morphogenesis [inference]

embryonic heart tube morphogenesis

embryonic morphogenesis [inference]

embryonic heart tube morphogenesis

tissue morphogenesis [inference]

morphogenesis of an epithelium [inference]

epithelial tube morphogenesis [inference]

embryonic heart tube morphogenesis

anatomical structure development [inference]

blastocyst development

tissue development [inference]

mesoderm development [inference]

mesenchyme development [inference]

regeneration [inference]

tissue regeneration [inference]

cardiac muscle tissue regeneration

cell development [inference]

epithelial cell development [inference]

columnar/cuboidal epithelial cell development [inference]

intestinal epithelial cell development

animal organ development [inference]

embryonic organ development [inference]

notochord development

cellular developmental process [inference]

cell differentiation [inference]

epithelial cell differentiation [inference]

columnar/cuboidal epithelial cell differentiation [inference]

glandular epithelial cell differentiation

intestinal epithelial cell differentiation

enterocyte differentiation

epidermal cell differentiation [inference]

keratinocyte differentiation

lung epithelial cell differentiation

lung cell differentiation [inference]

lung epithelial cell differentiation

cell development [inference]

epithelial cell development [inference]

columnar/cuboidal epithelial cell development [inference]

intestinal epithelial cell development

maintenance of cell number [inference]

stem cell population maintenance [inference]

somatic stem cell population maintenance

growth [inference]

developmental growth [inference]

organ growth

tissue regeneration [inference]

cardiac muscle tissue regeneration

developmental growth involved in morphogenesis [inference]

axis elongation [inference]

branch elongation of an epithelium [inference]

bud elongation involved in lung branching

homeostatic process [inference]

multicellular organismal-level homeostasis [inference]

anatomical structure homeostasis [inference]

tissue homeostasis

response to stimulus [inference]

response to stress [inference]

response to wounding [inference]

wound healing

cellular response to stress [inference]

cellular response to DNA damage stimulus

signal transduction in response to DNA damage

response to abiotic stimulus [inference]

response to radiation [inference]

response to ionizing radiation [inference]

response to gamma radiation [inference]

cellular response to gamma radiation

cellular response to ionizing radiation [inference]

cellular response to gamma radiation

cellular response to radiation [inference]

cellular response to ionizing radiation [inference]

cellular response to gamma radiation

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to ionizing radiation [inference]

cellular response to gamma radiation

response to endogenous stimulus [inference]

response to hormone [inference]

response to steroid hormone [inference]

response to progesterone

response to chemical [inference]

response to hormone [inference]

response to steroid hormone [inference]

response to progesterone

response to lipid [inference]

response to retinoic acid [inference]

cellular response to retinoic acid

response to steroid hormone [inference]

response to progesterone

cellular response to lipid [inference]

cellular response to retinoic acid

cellular response to chemical stimulus [inference]

cellular response to lipid [inference]

cellular response to retinoic acid

cellular response to oxygen-containing compound [inference]

cellular response to retinoic acid

response to oxygen-containing compound [inference]

response to retinoic acid [inference]

cellular response to retinoic acid

response to ketone [inference]

response to progesterone

cellular response to oxygen-containing compound [inference]

cellular response to retinoic acid

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to DNA damage stimulus

signal transduction in response to DNA damage

cellular response to chemical stimulus [inference]

cellular response to lipid [inference]

cellular response to retinoic acid

cellular response to oxygen-containing compound [inference]

cellular response to retinoic acid

cellular response to environmental stimulus [inference]

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to ionizing radiation [inference]

cellular response to gamma radiation

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

regulation of Notch signaling pathway [inference]

positive regulation of Notch signaling pathway

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of Notch signaling pathway

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

regulation of Wnt signaling pathway [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

regulation of canonical Wnt signaling pathway

positive regulation of canonical Wnt signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of Notch signaling pathway

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

regulation of localization [inference]

regulation of protein localization [inference]

regulation of protein localization to nucleus [inference]

positive regulation of protein localization to nucleus

positive regulation of protein localization [inference]

positive regulation of protein localization to nucleus

regulation of growth [inference]

regulation of cell growth [inference]

positive regulation of cell growth

positive regulation of growth [inference]

positive regulation of cell growth

positive regulation of developmental growth [inference]

positive regulation of organ growth

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

regulation of developmental growth [inference]

regulation of organ growth [inference]

positive regulation of organ growth

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

regulation of heart growth [inference]

regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

regulation of cardiac muscle cell proliferation [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of developmental growth [inference]

positive regulation of organ growth

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of Notch signaling pathway

positive regulation of growth [inference]

positive regulation of cell growth

positive regulation of developmental growth [inference]

positive regulation of organ growth

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of Notch signaling pathway

positive regulation of cell growth

positive regulation of cell differentiation [inference]

positive regulation of osteoblast differentiation

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of Notch signaling pathway

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of osteoblast differentiation

positive regulation of developmental growth [inference]

positive regulation of organ growth

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of stem cell population maintenance

positive regulation of multicellular organismal process [inference]

positive regulation of organ growth

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of stem cell population maintenance

positive regulation of protein localization [inference]

positive regulation of protein localization to nucleus

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of epithelial cell apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

negative regulation of cell differentiation [inference]

negative regulation of cellular component organization [inference]

negative regulation of organelle organization [inference]

negative regulation of organelle assembly [inference]

negative regulation of cilium assembly

negative regulation of cell projection organization [inference]

negative regulation of plasma membrane bounded cell projection assembly [inference]

negative regulation of cilium assembly

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

regulation of Notch signaling pathway [inference]

positive regulation of Notch signaling pathway

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of Notch signaling pathway

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

regulation of Wnt signaling pathway [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

regulation of canonical Wnt signaling pathway

positive regulation of canonical Wnt signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of Notch signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

regulation of developmental process [inference]

regulation of cell differentiation [inference]

regulation of epithelial cell differentiation [inference]

negative regulation of epithelial cell differentiation

regulation of epithelial cell differentiation involved in kidney development [inference]

regulation of nephron tubule epithelial cell differentiation [inference]

regulation of metanephric nephron tubule epithelial cell differentiation

negative regulation of cell differentiation [inference]

positive regulation of cell differentiation [inference]

positive regulation of osteoblast differentiation

regulation of fat cell differentiation [inference]

negative regulation of fat cell differentiation

regulation of osteoblast differentiation [inference]

positive regulation of osteoblast differentiation

regulation of cell development [inference]

regulation of neurogenesis

regulation of stem cell differentiation [inference]

negative regulation of stem cell differentiation

regulation of developmental growth [inference]

regulation of organ growth [inference]

positive regulation of organ growth

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

regulation of heart growth [inference]

regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

regulation of cardiac muscle cell proliferation [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of developmental growth [inference]

positive regulation of organ growth

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of osteoblast differentiation

positive regulation of developmental growth [inference]

positive regulation of organ growth

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of stem cell population maintenance

regulation of multicellular organismal development [inference]

regulation of epithelial cell differentiation [inference]

negative regulation of epithelial cell differentiation

regulation of epithelial cell differentiation involved in kidney development [inference]

regulation of nephron tubule epithelial cell differentiation [inference]

regulation of metanephric nephron tubule epithelial cell differentiation

regulation of nervous system development [inference]

regulation of neurogenesis

regulation of heart growth [inference]

regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

regulation of cardiac muscle cell proliferation [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

regulation of stem cell population maintenance [inference]

positive regulation of stem cell population maintenance

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

cytokine-mediated signaling pathway [inference]

interleukin-6-mediated signaling pathway

intracellular signal transduction [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of Notch signaling pathway [inference]

positive regulation of Notch signaling pathway

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of Notch signaling pathway

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

regulation of Wnt signaling pathway [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

regulation of canonical Wnt signaling pathway

positive regulation of canonical Wnt signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of Notch signaling pathway

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of cell population proliferation

positive regulation of cell population proliferation

regulation of epithelial cell proliferation [inference]

regulation of cardiac muscle cell proliferation [inference]

positive regulation of cardiac muscle cell proliferation

regulation of stem cell proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process [inference]

negative regulation of epithelial cell apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

regulation of epithelial cell apoptotic process [inference]

negative regulation of epithelial cell apoptotic process

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of epithelial cell apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

regulation of cellular component biogenesis [inference]

regulation of cell projection assembly [inference]

regulation of plasma membrane bounded cell projection assembly [inference]

negative regulation of plasma membrane bounded cell projection assembly [inference]

negative regulation of cilium assembly

regulation of cilium assembly [inference]

negative regulation of cilium assembly

regulation of organelle assembly [inference]

regulation of cilium assembly [inference]

negative regulation of cilium assembly

negative regulation of organelle assembly [inference]

negative regulation of cilium assembly

regulation of cell differentiation [inference]

regulation of epithelial cell differentiation [inference]

negative regulation of epithelial cell differentiation

regulation of epithelial cell differentiation involved in kidney development [inference]

regulation of nephron tubule epithelial cell differentiation [inference]

regulation of metanephric nephron tubule epithelial cell differentiation

negative regulation of cell differentiation [inference]

positive regulation of cell differentiation [inference]

positive regulation of osteoblast differentiation

regulation of fat cell differentiation [inference]

negative regulation of fat cell differentiation

regulation of osteoblast differentiation [inference]

positive regulation of osteoblast differentiation

regulation of cell development [inference]

regulation of neurogenesis

regulation of stem cell differentiation [inference]

negative regulation of stem cell differentiation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of Notch signaling pathway

positive regulation of cell growth

positive regulation of cell differentiation [inference]

positive regulation of osteoblast differentiation

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of epithelial cell apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway

negative regulation of cell differentiation [inference]

negative regulation of cellular component organization [inference]

negative regulation of organelle organization [inference]

negative regulation of organelle assembly [inference]

negative regulation of cilium assembly

negative regulation of cell projection organization [inference]

negative regulation of plasma membrane bounded cell projection assembly [inference]

negative regulation of cilium assembly

regulation of cellular component organization [inference]

regulation of cell growth [inference]

positive regulation of cell growth

regulation of cell projection organization [inference]

negative regulation of cell projection organization [inference]

negative regulation of plasma membrane bounded cell projection assembly [inference]

negative regulation of cilium assembly

regulation of cell projection assembly [inference]

regulation of plasma membrane bounded cell projection assembly [inference]

negative regulation of plasma membrane bounded cell projection assembly [inference]

negative regulation of cilium assembly

regulation of cilium assembly [inference]

negative regulation of cilium assembly

regulation of plasma membrane bounded cell projection organization [inference]

regulation of plasma membrane bounded cell projection assembly [inference]

negative regulation of plasma membrane bounded cell projection assembly [inference]

negative regulation of cilium assembly

regulation of cilium assembly [inference]

negative regulation of cilium assembly

regulation of organelle organization [inference]

negative regulation of organelle organization [inference]

negative regulation of organelle assembly [inference]

negative regulation of cilium assembly

regulation of organelle assembly [inference]

regulation of cilium assembly [inference]

negative regulation of cilium assembly

negative regulation of organelle assembly [inference]

negative regulation of cilium assembly

negative regulation of cellular component organization [inference]

negative regulation of organelle organization [inference]

negative regulation of organelle assembly [inference]

negative regulation of cilium assembly

negative regulation of cell projection organization [inference]

negative regulation of plasma membrane bounded cell projection assembly [inference]

negative regulation of cilium assembly

regulation of multicellular organismal process [inference]

regulation of organ growth [inference]

positive regulation of organ growth

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

regulation of heart growth [inference]

regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

regulation of cardiac muscle cell proliferation [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of multicellular organismal process [inference]

positive regulation of organ growth

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of stem cell population maintenance

regulation of multicellular organismal development [inference]

regulation of epithelial cell differentiation [inference]

negative regulation of epithelial cell differentiation

regulation of epithelial cell differentiation involved in kidney development [inference]

regulation of nephron tubule epithelial cell differentiation [inference]

regulation of metanephric nephron tubule epithelial cell differentiation

regulation of nervous system development [inference]

regulation of neurogenesis

regulation of heart growth [inference]

regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

regulation of cardiac muscle cell proliferation [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

regulation of stem cell population maintenance [inference]

positive regulation of stem cell population maintenance

Displaying entries **1 - 5** of 24 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
female germ cell nucleus
nucleus	ISS	GO_REF
nucleus	ISO	GO_REF
nucleus	IEA	GO_REF GO_REF
nucleoplasm	ISO	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

transcription regulator complex

RNA polymerase II transcription regulator complex [inference]

TEAD-YAP complex

nuclear protein-containing complex [inference]

RNA polymerase II transcription regulator complex [inference]

TEAD-YAP complex

cellular anatomical structure [inference]

membrane

plasma membrane

cell junction

anchoring junction [inference]

cell-cell junction

tight junction

bicellular tight junction

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

germ cell nucleus [inference]

female germ cell nucleus

mitochondrion

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

germ cell nucleus [inference]

female germ cell nucleus

mitochondrion

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
transcription cis-regulatory region binding	ISS	GO_REF
transcription cis-regulatory region binding	ISO	GO_REF
RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISO	GO_REF
chromatin binding	ISO	GO_REF
transcription coregulator activity	ISO	GO_REF

GO Hierarchy

molecular function

binding [inference]

nucleic acid binding [inference]

transcription regulatory region nucleic acid binding [inference]

transcription cis-regulatory region binding

RNA polymerase II transcription regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

cis-regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

DNA binding [inference]

double-stranded DNA binding [inference]

sequence-specific double-stranded DNA binding [inference]

transcription cis-regulatory region binding

RNA polymerase II transcription regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

cis-regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

sequence-specific DNA binding [inference]

sequence-specific double-stranded DNA binding [inference]

transcription cis-regulatory region binding

RNA polymerase II transcription regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

cis-regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

chromatin binding

protein binding [inference]

transcription factor binding [inference]

DNA-binding transcription factor binding

proline-rich region binding

transcription regulator activity [inference]

transcription coregulator activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MEPAQQPPPQPAPQGPAPPSVSPAGTPAAPPAPPAGHQVVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAGTLTASGVVSGPAATPAAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHNDQTTTWQDPRKAMLSQLNVPTSASPAVPQTLMNSASGPLPDGWEQAMTQDGEVYYINHKNKTTSWLDPRLDPRFAMNQRITQSAPVKQPPPLAPQSPQGGVLGGGSSNQQQQIQLQQLQMEKERLRLKQQELFRQELALRSQLPSLEQDGGTQNAVSSPGMTQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSIPRTPDDFLNSVDEMDTGDTISQSTLPSQQSRFPDYLEALPGTNVDLGTLEGDAMNIEGEELMPSLQEALSSEILDVESVLAATKLDKESFLTWL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
26				GlyGen
136				GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 6** entries
Pathway Name	Organism
Nuclear signaling by ERBB4	Rattus norvegicus
RUNX1 regulates transcription of genes involved in differentiation of HSCs	Rattus norvegicus
RUNX3 regulates YAP1-mediated transcription	Rattus norvegicus
Signaling by Hippo	Rattus norvegicus
Turbulent (oscillatory, disturbed) flow shear stress activates signaling by PIEZO1 and integrins in endothelial cells	Rattus norvegicus
YAP1- and WWTR1 (TAZ)-stimulated gene expression	Rattus norvegicus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements