GlyCosmos Portal

Submissions

Protein ATP1B4

Summary

UniProt ID: Q2HZ96
Gene Symbol: ATP1B4
Gene ID: 422365
Organism: Gallus gallus (chicken)

External Links

PubChem: Q2HZ96
Re-Glyco: Q2HZ96

Annotation

Keyword: Disulfide bond Glycoprotein Hydrogen ion transport Reference proteome Signal-anchor Transmembrane helix

Gene Ontology (GO)

Displaying **all 5** entries
GO Term	Evidence Code	Reference
regulation of transcription, DNA-templated	IBA	GO_REF
regulation of DNA-templated transcription	IBA	GO_REF
potassium ion transport	IEA	GO_REF
sodium ion transport	IEA	GO_REF
proton transmembrane transport

GO Hierarchy

biological process

cellular process [inference]

transmembrane transport [inference]

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

proton transmembrane transport

localization [inference]

establishment of localization [inference]

transport [inference]

monoatomic ion transport [inference]

monoatomic cation transport [inference]

metal ion transport [inference]

monoatomic cation transmembrane transport [inference]

proton transmembrane transport

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

proton transmembrane transport

transmembrane transport [inference]

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

proton transmembrane transport

biological regulation [inference]

regulation of biological process [inference]

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of transcription, DNA-templated

regulation of RNA biosynthetic process [inference]

regulation of transcription, DNA-templated

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of transcription, DNA-templated

regulation of RNA biosynthetic process [inference]

regulation of transcription, DNA-templated

regulation of RNA metabolic process [inference]

regulation of RNA biosynthetic process [inference]

regulation of transcription, DNA-templated

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

regulation of RNA metabolic process [inference]

regulation of RNA biosynthetic process [inference]

regulation of transcription, DNA-templated

Displaying **all 2** entries
GO Term	Evidence Code	Reference
nuclear inner membrane	IBA	GO_REF
sodium:potassium-exchanging ATPase complex	IEA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

membrane protein complex [inference]

plasma membrane protein complex [inference]

sodium:potassium-exchanging ATPase complex

transmembrane transporter complex [inference]

ATPase dependent transmembrane transport complex [inference]

cation-transporting ATPase complex [inference]

sodium:potassium-exchanging ATPase complex

transporter complex [inference]

transmembrane transporter complex [inference]

ATPase dependent transmembrane transport complex [inference]

cation-transporting ATPase complex [inference]

sodium:potassium-exchanging ATPase complex

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

organelle inner membrane [inference]

nuclear inner membrane

nuclear membrane [inference]

nuclear inner membrane

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MEPGMEMNTASEGGTRRGPENKHEEKVQDPNRGEAETKAEMGNKTWADLAGEMKTFLWNPEERTCMGRTAKSWGLILLFYFIFYTCLAGMFAFCMYVMLLTLSPYTPTYRDRVSPPGVMIRPYLNGFTIAFNVSKPSTWQPYVDSMHQFLAAYDDKVQEEKNIECISGQYFIQGGNDSEEKKACQFKRSLLQNCSGIEDPTFGFSKGQPCILLKMNRIIGYRPGAGVPVNVDCKVQKGNESDLRSVDFYPGNGTFDLMYYPYYGKLTHVNYTSPLVAMHFTDVKRNSLVHIQCKLNGKGIINDVNSDRFLGRIIFTLSIGK

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 6** entries
Position	Description	Source
132	N-linked (GlcNAc...) asparagine	UniProt
176	N-linked (GlcNAc...) asparagine	UniProt
193	N-linked (GlcNAc...) asparagine	UniProt
239	N-linked (GlcNAc...) asparagine	UniProt
252	N-linked (GlcNAc...) asparagine	UniProt
270	N-linked (GlcNAc...) asparagine	UniProt