GlyCosmos Portal

Submissions

Bone morphogenetic protein 4

Summary

UniProt ID: Q2KJH1
Gene Symbol: BMP4
Gene ID: 407216
Organism: Bos taurus (domestic cattle)

External Links

PubChem: Q2KJH1
Re-Glyco: Q2KJH1

Annotation

Keyword: Chondrogenesis Cleavage on pair of basic residues Cytokine Developmental protein Differentiation Disulfide bond Extracellular matrix Glycoprotein Growth factor Osteogenesis Phosphoprotein Reference proteome Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 55 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
osteoblast differentiation	ISS	GO_REF
branching involved in ureteric bud morphogenesis	ISS	GO_REF
kidney development	ISS	GO_REF
mesonephros development	ISS	GO_REF
endochondral ossification	ISS	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein serine/threonine kinase signaling pathway [inference]

transforming growth factor beta receptor superfamily signaling pathway [inference]

BMP signaling pathway

cell population proliferation [inference]

epithelial cell proliferation [inference]

endothelial cell proliferation [inference]

blood vessel endothelial cell proliferation involved in sprouting angiogenesis

cellular developmental process [inference]

cell differentiation [inference]

hematopoietic progenitor cell differentiation

lymphoid progenitor cell differentiation

tendon cell differentiation

mesodermal cell differentiation [inference]

intermediate mesodermal cell differentiation

cell development [inference]

epithelial cell development [inference]

type B pancreatic cell development

multicellular organismal process [inference]

ossification [inference]

replacement ossification [inference]

endochondral ossification

morphogenesis of a branching structure [inference]

morphogenesis of a branching epithelium [inference]

branching morphogenesis of an epithelial tube [inference]

pattern specification process [inference]

regionalization [inference]

specification of animal organ identity [inference]

heart field specification [inference]

secondary heart field specification

developmental process [inference]

anatomical structure morphogenesis [inference]

morphogenesis of a branching structure [inference]

morphogenesis of a branching epithelium [inference]

branching morphogenesis of an epithelial tube [inference]

animal organ morphogenesis [inference]

tube morphogenesis [inference]

branching morphogenesis of an epithelial tube [inference]

tissue morphogenesis [inference]

morphogenesis of an epithelium [inference]

morphogenesis of a branching epithelium [inference]

branching morphogenesis of an epithelial tube [inference]

developmental induction [inference]

organ induction [inference]

heart induction

anatomical structure formation involved in morphogenesis [inference]

angiogenesis [inference]

glomerular capillary formation

tube formation [inference]

epithelial tube formation [inference]

nephric duct formation

anatomical structure development [inference]

tissue development [inference]

muscle tissue development [inference]

smooth muscle tissue development

deltoid tuberosity development

cell development [inference]

epithelial cell development [inference]

type B pancreatic cell development

animal organ development [inference]

kidney development

mesonephros development

system development [inference]

vasculature development [inference]

lung vasculature development

cellular developmental process [inference]

cell differentiation [inference]

hematopoietic progenitor cell differentiation

lymphoid progenitor cell differentiation

tendon cell differentiation

mesodermal cell differentiation [inference]

intermediate mesodermal cell differentiation

cell development [inference]

epithelial cell development [inference]

type B pancreatic cell development

locomotion [inference]

taxis [inference]

chemotaxis [inference]

positive chemotaxis

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

negative regulation of immune system process [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

regulation of lymphocyte activation [inference]

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

regulation of T cell differentiation in thymus [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

regulation of immature T cell proliferation [inference]

regulation of immature T cell proliferation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

regulation of immature T cell proliferation [inference]

regulation of immature T cell proliferation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

regulation of T cell differentiation [inference]

regulation of T cell differentiation in thymus [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

regulation of hemopoiesis [inference]

regulation of leukocyte differentiation [inference]

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

regulation of T cell differentiation in thymus [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of BMP signaling pathway [inference]

positive regulation of BMP signaling pathway

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade

regulation of SMAD protein signal transduction [inference]

positive regulation of SMAD protein signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

regulation of localization [inference]

regulation of protein localization [inference]

regulation of protein localization to nucleus [inference]

positive regulation of protein localization to nucleus

positive regulation of protein localization [inference]

positive regulation of protein localization to nucleus

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of epithelial cell proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of collagen biosynthetic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of collagen metabolic process [inference]

positive regulation of collagen biosynthetic process

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of cardiac muscle fiber development

positive regulation of epithelial cell differentiation [inference]

positive regulation of epidermal cell differentiation

positive regulation of neuroepithelial cell differentiation [inference]

positive regulation of odontoblast differentiation

positive regulation of osteoblast differentiation

positive regulation of muscle cell differentiation [inference]

positive regulation of striated muscle cell differentiation [inference]

positive regulation of cardiac muscle cell differentiation [inference]

positive regulation of cardiac muscle fiber development

positive regulation of cardiocyte differentiation [inference]

positive regulation of cardiac muscle cell differentiation [inference]

positive regulation of cardiac muscle fiber development

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of cardiac muscle fiber development

positive regulation of epithelial cell differentiation [inference]

positive regulation of epidermal cell differentiation

positive regulation of neuroepithelial cell differentiation [inference]

positive regulation of odontoblast differentiation

positive regulation of osteoblast differentiation

positive regulation of muscle cell differentiation [inference]

positive regulation of striated muscle cell differentiation [inference]

positive regulation of cardiac muscle cell differentiation [inference]

positive regulation of cardiac muscle fiber development

positive regulation of cardiocyte differentiation [inference]

positive regulation of cardiac muscle cell differentiation [inference]

positive regulation of cardiac muscle fiber development

positive regulation of epidermis development [inference]

positive regulation of epidermal cell differentiation

positive regulation of biomineral tissue development [inference]

positive regulation of bone mineralization

positive regulation of animal organ morphogenesis [inference]

organ induction [inference]

heart induction

positive regulation of morphogenesis of an epithelium [inference]

positive regulation of branching involved in lung morphogenesis

positive regulation of multicellular organismal process [inference]

positive regulation of ossification [inference]

positive regulation of bone mineralization

positive regulation of branching involved in lung morphogenesis

positive regulation of animal organ morphogenesis [inference]

organ induction [inference]

heart induction

positive regulation of cardiocyte differentiation [inference]

positive regulation of cardiac muscle cell differentiation [inference]

positive regulation of cardiac muscle fiber development

positive regulation of protein localization [inference]

positive regulation of protein localization to nucleus

negative regulation of biological process [inference]

negative regulation of immune system process [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of cell population proliferation

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of mesenchymal cell proliferation [inference]

negative regulation of mesenchymal cell proliferation involved in ureter development

negative regulation of cell proliferation involved in kidney development [inference]

negative regulation of glomerular mesangial cell proliferation

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of leukocyte apoptotic process [inference]

negative regulation of lymphocyte apoptotic process [inference]

negative regulation of T cell apoptotic process [inference]

negative regulation of thymocyte apoptotic process

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of cell cycle

negative regulation of cell cycle process [inference]

negative regulation of mitotic nuclear division

negative regulation of mitotic cell cycle [inference]

negative regulation of mitotic nuclear division

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of cellular component organization [inference]

negative regulation of organelle organization [inference]

negative regulation of nuclear division [inference]

negative regulation of mitotic nuclear division

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of mesenchymal cell proliferation involved in ureter development

negative regulation of kidney development [inference]

negative regulation of glomerulus development

negative regulation of morphogenesis of an epithelium [inference]

negative regulation of branching involved in ureteric bud morphogenesis

negative regulation of multicellular organismal process [inference]

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of mesenchymal cell proliferation involved in ureter development

negative regulation of kidney development [inference]

negative regulation of glomerulus development

negative regulation of branching involved in ureteric bud morphogenesis

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of BMP signaling pathway [inference]

positive regulation of BMP signaling pathway

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade

regulation of SMAD protein signal transduction [inference]

positive regulation of SMAD protein signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

regulation of cellular response to growth factor stimulus [inference]

regulation of BMP signaling pathway [inference]

positive regulation of BMP signaling pathway

regulation of developmental process [inference]

regulation of cell fate commitment

regulation of anatomical structure morphogenesis [inference]

regulation of morphogenesis of a branching structure [inference]

regulation of branching involved in lung morphogenesis [inference]

positive regulation of branching involved in lung morphogenesis

regulation of branching involved in ureteric bud morphogenesis [inference]

negative regulation of branching involved in ureteric bud morphogenesis

regulation of morphogenesis of an epithelium [inference]

regulation of branching involved in lung morphogenesis [inference]

positive regulation of branching involved in lung morphogenesis

regulation of branching involved in ureteric bud morphogenesis [inference]

negative regulation of branching involved in ureteric bud morphogenesis

negative regulation of morphogenesis of an epithelium [inference]

negative regulation of branching involved in ureteric bud morphogenesis

positive regulation of morphogenesis of an epithelium [inference]

positive regulation of branching involved in lung morphogenesis

regulation of animal organ morphogenesis [inference]

regulation of animal organ formation [inference]

organ induction [inference]

heart induction

regulation of branching involved in ureteric bud morphogenesis [inference]

negative regulation of branching involved in ureteric bud morphogenesis

positive regulation of animal organ morphogenesis [inference]

organ induction [inference]

heart induction

regulation of metanephric S-shaped body morphogenesis [inference]

negative regulation of metanephric S-shaped body morphogenesis

regulation of metanephric comma-shaped body morphogenesis [inference]

negative regulation of metanephric comma-shaped body morphogenesis

regulation of heart morphogenesis [inference]

heart induction

regulation of cell differentiation [inference]

regulation of epithelial cell differentiation [inference]

positive regulation of epithelial cell differentiation [inference]

positive regulation of epidermal cell differentiation

positive regulation of neuroepithelial cell differentiation [inference]

positive regulation of odontoblast differentiation

regulation of epidermal cell differentiation [inference]

positive regulation of epidermal cell differentiation

regulation of odontoblast differentiation [inference]

positive regulation of odontoblast differentiation

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of cardiac muscle fiber development

positive regulation of epithelial cell differentiation [inference]

positive regulation of epidermal cell differentiation

positive regulation of neuroepithelial cell differentiation [inference]

positive regulation of odontoblast differentiation

positive regulation of osteoblast differentiation

positive regulation of muscle cell differentiation [inference]

positive regulation of striated muscle cell differentiation [inference]

positive regulation of cardiac muscle cell differentiation [inference]

positive regulation of cardiac muscle fiber development

positive regulation of cardiocyte differentiation [inference]

positive regulation of cardiac muscle cell differentiation [inference]

positive regulation of cardiac muscle fiber development

regulation of osteoblast differentiation [inference]

positive regulation of osteoblast differentiation

regulation of muscle cell differentiation [inference]

positive regulation of muscle cell differentiation [inference]

positive regulation of striated muscle cell differentiation [inference]

positive regulation of cardiac muscle cell differentiation [inference]

positive regulation of cardiac muscle fiber development

regulation of striated muscle cell differentiation [inference]

positive regulation of striated muscle cell differentiation [inference]

positive regulation of cardiac muscle cell differentiation [inference]

positive regulation of cardiac muscle fiber development

regulation of cardiac muscle cell differentiation [inference]

regulation of cardiac muscle fiber development [inference]

positive regulation of cardiac muscle fiber development

positive regulation of cardiac muscle cell differentiation [inference]

positive regulation of cardiac muscle fiber development

regulation of cell development [inference]

positive regulation of cell development [inference]

positive regulation of cardiac muscle fiber development

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

regulation of cardiac muscle fiber development [inference]

positive regulation of cardiac muscle fiber development

regulation of hemopoiesis [inference]

regulation of leukocyte differentiation [inference]

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

regulation of T cell differentiation in thymus [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

regulation of cardiocyte differentiation [inference]

positive regulation of cardiocyte differentiation [inference]

positive regulation of cardiac muscle cell differentiation [inference]

positive regulation of cardiac muscle fiber development

regulation of cardiac muscle cell differentiation [inference]

regulation of cardiac muscle fiber development [inference]

positive regulation of cardiac muscle fiber development

positive regulation of cardiac muscle cell differentiation [inference]

positive regulation of cardiac muscle fiber development

regulation of epidermis development [inference]

regulation of epidermal cell differentiation [inference]

positive regulation of epidermal cell differentiation

positive regulation of epidermis development [inference]

positive regulation of epidermal cell differentiation

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of mesenchymal cell proliferation involved in ureter development

negative regulation of kidney development [inference]

negative regulation of glomerulus development

negative regulation of morphogenesis of an epithelium [inference]

negative regulation of branching involved in ureteric bud morphogenesis

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of cardiac muscle fiber development

positive regulation of epithelial cell differentiation [inference]

positive regulation of epidermal cell differentiation

positive regulation of neuroepithelial cell differentiation [inference]

positive regulation of odontoblast differentiation

positive regulation of osteoblast differentiation

positive regulation of muscle cell differentiation [inference]

positive regulation of striated muscle cell differentiation [inference]

positive regulation of cardiac muscle cell differentiation [inference]

positive regulation of cardiac muscle fiber development

positive regulation of cardiocyte differentiation [inference]

positive regulation of cardiac muscle cell differentiation [inference]

positive regulation of cardiac muscle fiber development

positive regulation of epidermis development [inference]

positive regulation of epidermal cell differentiation

positive regulation of biomineral tissue development [inference]

positive regulation of bone mineralization

positive regulation of animal organ morphogenesis [inference]

organ induction [inference]

heart induction

positive regulation of morphogenesis of an epithelium [inference]

positive regulation of branching involved in lung morphogenesis

regulation of kidney development [inference]

negative regulation of kidney development [inference]

negative regulation of glomerulus development

regulation of branching involved in ureteric bud morphogenesis [inference]

negative regulation of branching involved in ureteric bud morphogenesis

regulation of glomerulus development [inference]

negative regulation of glomerulus development

regulation of multicellular organismal development [inference]

regulation of epithelial cell differentiation [inference]

positive regulation of epithelial cell differentiation [inference]

positive regulation of epidermal cell differentiation

positive regulation of neuroepithelial cell differentiation [inference]

positive regulation of odontoblast differentiation

regulation of epidermal cell differentiation [inference]

positive regulation of epidermal cell differentiation

regulation of odontoblast differentiation [inference]

positive regulation of odontoblast differentiation

regulation of biomineral tissue development [inference]

regulation of bone mineralization [inference]

positive regulation of bone mineralization

positive regulation of biomineral tissue development [inference]

positive regulation of bone mineralization

regulation of hemopoiesis [inference]

regulation of leukocyte differentiation [inference]

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

regulation of T cell differentiation in thymus [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein serine/threonine kinase signaling pathway [inference]

transforming growth factor beta receptor superfamily signaling pathway [inference]

BMP signaling pathway

regulation of cell fate commitment

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of BMP signaling pathway [inference]

positive regulation of BMP signaling pathway

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade

regulation of SMAD protein signal transduction [inference]

positive regulation of SMAD protein signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of collagen biosynthetic process

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of collagen biosynthetic process [inference]

positive regulation of collagen biosynthetic process

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of collagen biosynthetic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of collagen metabolic process [inference]

positive regulation of collagen biosynthetic process

regulation of collagen metabolic process [inference]

positive regulation of collagen metabolic process [inference]

positive regulation of collagen biosynthetic process

regulation of collagen biosynthetic process [inference]

positive regulation of collagen biosynthetic process

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of cell adhesion [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

regulation of cell-cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

regulation of leukocyte cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

positive regulation of epithelial cell proliferation

negative regulation of cell population proliferation

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of mesenchymal cell proliferation [inference]

negative regulation of mesenchymal cell proliferation involved in ureter development

negative regulation of cell proliferation involved in kidney development [inference]

negative regulation of glomerular mesangial cell proliferation

regulation of mesenchymal cell proliferation [inference]

negative regulation of mesenchymal cell proliferation [inference]

negative regulation of mesenchymal cell proliferation involved in ureter development

regulation of epithelial cell proliferation [inference]

positive regulation of epithelial cell proliferation

regulation of leukocyte proliferation [inference]

regulation of mononuclear cell proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

regulation of immature T cell proliferation [inference]

regulation of immature T cell proliferation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

regulation of glomerular mesangial cell proliferation [inference]

negative regulation of glomerular mesangial cell proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process [inference]

negative regulation of leukocyte apoptotic process [inference]

negative regulation of lymphocyte apoptotic process [inference]

negative regulation of T cell apoptotic process [inference]

negative regulation of thymocyte apoptotic process

regulation of leukocyte apoptotic process [inference]

regulation of lymphocyte apoptotic process [inference]

negative regulation of lymphocyte apoptotic process [inference]

negative regulation of T cell apoptotic process [inference]

negative regulation of thymocyte apoptotic process

regulation of T cell apoptotic process [inference]

negative regulation of T cell apoptotic process [inference]

negative regulation of thymocyte apoptotic process

regulation of thymocyte apoptotic process [inference]

negative regulation of thymocyte apoptotic process

negative regulation of leukocyte apoptotic process [inference]

negative regulation of lymphocyte apoptotic process [inference]

negative regulation of T cell apoptotic process [inference]

negative regulation of thymocyte apoptotic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of leukocyte apoptotic process [inference]

negative regulation of lymphocyte apoptotic process [inference]

negative regulation of T cell apoptotic process [inference]

negative regulation of thymocyte apoptotic process

regulation of cell differentiation [inference]

regulation of epithelial cell differentiation [inference]

positive regulation of epithelial cell differentiation [inference]

positive regulation of epidermal cell differentiation

positive regulation of neuroepithelial cell differentiation [inference]

positive regulation of odontoblast differentiation

regulation of epidermal cell differentiation [inference]

positive regulation of epidermal cell differentiation

regulation of odontoblast differentiation [inference]

positive regulation of odontoblast differentiation

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of cardiac muscle fiber development

positive regulation of epithelial cell differentiation [inference]

positive regulation of epidermal cell differentiation

positive regulation of neuroepithelial cell differentiation [inference]

positive regulation of odontoblast differentiation

positive regulation of osteoblast differentiation

positive regulation of muscle cell differentiation [inference]

positive regulation of striated muscle cell differentiation [inference]

positive regulation of cardiac muscle cell differentiation [inference]

positive regulation of cardiac muscle fiber development

positive regulation of cardiocyte differentiation [inference]

positive regulation of cardiac muscle cell differentiation [inference]

positive regulation of cardiac muscle fiber development

regulation of osteoblast differentiation [inference]

positive regulation of osteoblast differentiation

regulation of muscle cell differentiation [inference]

positive regulation of muscle cell differentiation [inference]

positive regulation of striated muscle cell differentiation [inference]

positive regulation of cardiac muscle cell differentiation [inference]

positive regulation of cardiac muscle fiber development

regulation of striated muscle cell differentiation [inference]

positive regulation of striated muscle cell differentiation [inference]

positive regulation of cardiac muscle cell differentiation [inference]

positive regulation of cardiac muscle fiber development

regulation of cardiac muscle cell differentiation [inference]

regulation of cardiac muscle fiber development [inference]

positive regulation of cardiac muscle fiber development

positive regulation of cardiac muscle cell differentiation [inference]

positive regulation of cardiac muscle fiber development

regulation of cell development [inference]

positive regulation of cell development [inference]

positive regulation of cardiac muscle fiber development

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

regulation of cardiac muscle fiber development [inference]

positive regulation of cardiac muscle fiber development

regulation of hemopoiesis [inference]

regulation of leukocyte differentiation [inference]

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

regulation of T cell differentiation in thymus [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

regulation of cardiocyte differentiation [inference]

positive regulation of cardiocyte differentiation [inference]

positive regulation of cardiac muscle cell differentiation [inference]

positive regulation of cardiac muscle fiber development

regulation of cardiac muscle cell differentiation [inference]

regulation of cardiac muscle fiber development [inference]

positive regulation of cardiac muscle fiber development

positive regulation of cardiac muscle cell differentiation [inference]

positive regulation of cardiac muscle fiber development

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of epithelial cell proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of collagen biosynthetic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of collagen metabolic process [inference]

positive regulation of collagen biosynthetic process

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of SMAD protein signal transduction

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of cardiac muscle fiber development

positive regulation of epithelial cell differentiation [inference]

positive regulation of epidermal cell differentiation

positive regulation of neuroepithelial cell differentiation [inference]

positive regulation of odontoblast differentiation

positive regulation of osteoblast differentiation

positive regulation of muscle cell differentiation [inference]

positive regulation of striated muscle cell differentiation [inference]

positive regulation of cardiac muscle cell differentiation [inference]

positive regulation of cardiac muscle fiber development

positive regulation of cardiocyte differentiation [inference]

positive regulation of cardiac muscle cell differentiation [inference]

positive regulation of cardiac muscle fiber development

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of cell population proliferation

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of mesenchymal cell proliferation [inference]

negative regulation of mesenchymal cell proliferation involved in ureter development

negative regulation of cell proliferation involved in kidney development [inference]

negative regulation of glomerular mesangial cell proliferation

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of leukocyte apoptotic process [inference]

negative regulation of lymphocyte apoptotic process [inference]

negative regulation of T cell apoptotic process [inference]

negative regulation of thymocyte apoptotic process

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of cell cycle

negative regulation of cell cycle process [inference]

negative regulation of mitotic nuclear division

negative regulation of mitotic cell cycle [inference]

negative regulation of mitotic nuclear division

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of cellular component organization [inference]

negative regulation of organelle organization [inference]

negative regulation of nuclear division [inference]

negative regulation of mitotic nuclear division

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

regulation of lymphocyte activation [inference]

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

regulation of T cell differentiation in thymus [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

regulation of immature T cell proliferation [inference]

regulation of immature T cell proliferation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

regulation of immature T cell proliferation [inference]

regulation of immature T cell proliferation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

regulation of T cell differentiation [inference]

regulation of T cell differentiation in thymus [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

regulation of cellular component organization [inference]

regulation of organelle organization [inference]

negative regulation of organelle organization [inference]

negative regulation of nuclear division [inference]

negative regulation of mitotic nuclear division

regulation of nuclear division [inference]

regulation of mitotic nuclear division [inference]

negative regulation of mitotic nuclear division

negative regulation of nuclear division [inference]

negative regulation of mitotic nuclear division

negative regulation of cellular component organization [inference]

negative regulation of organelle organization [inference]

negative regulation of nuclear division [inference]

negative regulation of mitotic nuclear division

regulation of cell cycle [inference]

regulation of mitotic cell cycle [inference]

regulation of mitotic nuclear division [inference]

negative regulation of mitotic nuclear division

negative regulation of mitotic cell cycle [inference]

negative regulation of mitotic nuclear division

regulation of cell cycle process [inference]

regulation of mitotic nuclear division [inference]

negative regulation of mitotic nuclear division

negative regulation of cell cycle process [inference]

negative regulation of mitotic nuclear division

negative regulation of cell cycle

negative regulation of cell cycle process [inference]

negative regulation of mitotic nuclear division

negative regulation of mitotic cell cycle [inference]

negative regulation of mitotic nuclear division

regulation of multicellular organismal process [inference]

regulation of ossification [inference]

regulation of bone mineralization [inference]

positive regulation of bone mineralization

positive regulation of ossification [inference]

positive regulation of bone mineralization

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

regulation of lymphocyte activation [inference]

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

regulation of T cell differentiation in thymus [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

regulation of immature T cell proliferation [inference]

regulation of immature T cell proliferation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

regulation of immature T cell proliferation [inference]

regulation of immature T cell proliferation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

regulation of T cell differentiation [inference]

regulation of T cell differentiation in thymus [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

positive regulation of multicellular organismal process [inference]

positive regulation of ossification [inference]

positive regulation of bone mineralization

positive regulation of branching involved in lung morphogenesis

positive regulation of animal organ morphogenesis [inference]

organ induction [inference]

heart induction

positive regulation of cardiocyte differentiation [inference]

positive regulation of cardiac muscle cell differentiation [inference]

positive regulation of cardiac muscle fiber development

negative regulation of multicellular organismal process [inference]

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation [inference]

negative regulation of immature T cell proliferation [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of mesenchymal cell proliferation involved in ureter development

negative regulation of kidney development [inference]

negative regulation of glomerulus development

negative regulation of branching involved in ureteric bud morphogenesis

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

regulation of morphogenesis of a branching structure [inference]

regulation of branching involved in lung morphogenesis [inference]

positive regulation of branching involved in lung morphogenesis

regulation of branching involved in ureteric bud morphogenesis [inference]

negative regulation of branching involved in ureteric bud morphogenesis

regulation of multicellular organismal development [inference]

regulation of epithelial cell differentiation [inference]

positive regulation of epithelial cell differentiation [inference]

positive regulation of epidermal cell differentiation

positive regulation of neuroepithelial cell differentiation [inference]

positive regulation of odontoblast differentiation

regulation of epidermal cell differentiation [inference]

positive regulation of epidermal cell differentiation

regulation of odontoblast differentiation [inference]

positive regulation of odontoblast differentiation

regulation of biomineral tissue development [inference]

regulation of bone mineralization [inference]

positive regulation of bone mineralization

positive regulation of biomineral tissue development [inference]

positive regulation of bone mineralization

regulation of hemopoiesis [inference]

regulation of leukocyte differentiation [inference]

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

regulation of T cell differentiation in thymus [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of lymphocyte differentiation [inference]

negative regulation of T cell differentiation [inference]

negative regulation of T cell differentiation in thymus [inference]

negative regulation of immature T cell proliferation in thymus

Displaying 1 entry
GO Term	Evidence Code	Reference
obsolete extracellular space

GO Hierarchy

cellular component

Displaying **all 4** entries
GO Term	Evidence Code	Reference
cytokine activity	IBA	GO_REF
growth factor activity	IEA	GO_REF
chemoattractant activity	ISS	GO_REF
BMP receptor binding	ISS	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

receptor serine/threonine kinase binding [inference]

transmembrane receptor protein serine/threonine kinase binding [inference]

BMP receptor binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEEQIQGIGLEYPERPASRANTVRSFHHEEHLENIPGTSENSAFRFLFNLSSIPENEVISSAELRLFREQVDQGPDWDQGFHRINIYEVMKPPAEVVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVTHLHQTRTHQGQHVRISRSLPQGSGDWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHPQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	Source
144	N-linked (GlcNAc...) asparagine	UniProt
209	N-linked (GlcNAc...) asparagine	UniProt
351	N-linked (GlcNAc...) asparagine	UniProt
366	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 3** entries
Pathway Name	Organism
Molecules associated with elastic fibres	Bos taurus
Post-translational protein phosphorylation	Bos taurus
Regulation of IGF Activity by IGFBP	Bos taurus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements