GlyCosmos Portal

Submissions

Neuronal acetylcholine receptor subunit alpha-5

Summary

UniProt ID: Q2MKA5
Gene Symbol: Chrna5
Gene ID: 110835
Organism: Mus musculus (house mouse)

External Links

PubChem: Q2MKA5
Re-Glyco: Q2MKA5

Annotation

Keyword: Alternative splicing Cell membrane Disulfide bond Glycoprotein Ligand-gated ion channel Receptor Reference proteome Signal Synapse Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 23 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
synaptic transmission, cholinergic	IBA	GO_REF
neuromuscular synaptic transmission	IBA	GO_REF
ion transmembrane transport	IBA	GO_REF
monoatomic ion transmembrane transport	IBA	GO_REF
monoatomic ion transmembrane transport	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cell communication [inference]

cell-cell signaling [inference]

synaptic signaling [inference]

trans-synaptic signaling [inference]

anterograde trans-synaptic signaling [inference]

chemical synaptic transmission [inference]

signal transduction [inference]

postsynaptic signal transduction [inference]

acetylcholine receptor signaling pathway

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to nicotine

transmembrane transport [inference]

monoatomic ion transmembrane transport

multicellular organismal process [inference]

behavior [inference]

adult behavior [inference]

behavioral response to nicotine

response to stimulus [inference]

response to external stimulus [inference]

detection of external stimulus [inference]

detection of mechanical stimulus [inference]

detection of mechanical stimulus involved in sensory perception [inference]

detection of mechanical stimulus involved in sensory perception of pain

response to mechanical stimulus [inference]

detection of mechanical stimulus [inference]

detection of mechanical stimulus involved in sensory perception [inference]

detection of mechanical stimulus involved in sensory perception of pain

response to abiotic stimulus [inference]

detection of abiotic stimulus [inference]

detection of mechanical stimulus [inference]

detection of mechanical stimulus involved in sensory perception [inference]

detection of mechanical stimulus involved in sensory perception of pain

response to mechanical stimulus [inference]

detection of mechanical stimulus [inference]

detection of mechanical stimulus involved in sensory perception [inference]

detection of mechanical stimulus involved in sensory perception of pain

response to chemical [inference]

response to nicotine

cellular response to nicotine

cellular response to chemical stimulus [inference]

cellular response to nicotine

detection of stimulus [inference]

detection of external stimulus [inference]

detection of mechanical stimulus [inference]

detection of mechanical stimulus involved in sensory perception [inference]

detection of mechanical stimulus involved in sensory perception of pain

detection of abiotic stimulus [inference]

detection of mechanical stimulus [inference]

detection of mechanical stimulus involved in sensory perception [inference]

detection of mechanical stimulus involved in sensory perception of pain

detection of stimulus involved in sensory perception [inference]

detection of mechanical stimulus involved in sensory perception [inference]

detection of mechanical stimulus involved in sensory perception of pain

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to nicotine

localization [inference]

establishment of localization [inference]

transport [inference]

monoatomic ion transport [inference]

monoatomic ion transmembrane transport

transmembrane transport [inference]

monoatomic ion transmembrane transport

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

presynaptic modulation of chemical synaptic transmission

signaling [inference]

cell-cell signaling [inference]

synaptic signaling [inference]

trans-synaptic signaling [inference]

anterograde trans-synaptic signaling [inference]

chemical synaptic transmission [inference]

regulation of cellular process [inference]

signal transduction [inference]

postsynaptic signal transduction [inference]

acetylcholine receptor signaling pathway

regulation of cell communication [inference]

regulation of transmission of nerve impulse [inference]

regulation of neuronal action potential

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

presynaptic modulation of chemical synaptic transmission

regulation of multicellular organismal process [inference]

regulation of system process [inference]

regulation of nervous system process [inference]

regulation of transmission of nerve impulse [inference]

regulation of neuronal action potential

regulation of action potential [inference]

regulation of neuronal action potential

regulation of biological quality [inference]

regulation of membrane potential [inference]

membrane depolarization

regulation of action potential [inference]

regulation of neuronal action potential

Displaying entries **1 - 5** of 21 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
plasma membrane	ISS	GO_REF
plasma membrane	ISO	GO_REF
plasma membrane	IBA	GO_REF
plasma membrane	IEA	GO_REF GO_REF
acetylcholine-gated channel complex	ISS	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

signaling receptor complex [inference]

plasma membrane signaling receptor complex [inference]

membrane protein complex [inference]

plasma membrane protein complex [inference]

plasma membrane signaling receptor complex [inference]

transmembrane transporter complex [inference]

monoatomic ion channel complex [inference]

transporter complex [inference]

transmembrane transporter complex [inference]

monoatomic ion channel complex [inference]

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

plasma membrane region [inference]

synaptic membrane [inference]

postsynaptic membrane

cell junction [inference]

synapse

cell projection [inference]

plasma membrane bounded cell projection [inference]

neuron projection

dendrite

cell body [inference]

neuronal cell body

presynapse

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
acetylcholine receptor activity	ISO	GO_REF
acetylcholine receptor activity	IBA	GO_REF
acetylcholine receptor activity	IEA	GO_REF
acetylcholine-gated monoatomic cation-selective channel activity	ISO	GO_REF GO_REF
acetylcholine-gated monoatomic cation-selective channel activity	IBA	GO_REF

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity [inference]

monoatomic ion transmembrane transporter activity [inference]

monoatomic ion channel activity [inference]

monoatomic cation channel activity [inference]

ligand-gated monoatomic cation channel activity [inference]

acetylcholine-gated monoatomic cation-selective channel activity

ligand-gated monoatomic ion channel activity [inference]

extracellular ligand-gated monoatomic ion channel activity [inference]

excitatory extracellular ligand-gated monoatomic ion channel activity [inference]

acetylcholine-gated monoatomic cation-selective channel activity

transmitter-gated monoatomic ion channel activity [inference]

transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential [inference]

acetylcholine-gated monoatomic cation-selective channel activity

ligand-gated monoatomic cation channel activity [inference]

acetylcholine-gated monoatomic cation-selective channel activity

monoatomic cation transmembrane transporter activity [inference]

monoatomic cation channel activity [inference]

ligand-gated monoatomic cation channel activity [inference]

acetylcholine-gated monoatomic cation-selective channel activity

passive transmembrane transporter activity [inference]

channel activity [inference]

monoatomic ion channel activity [inference]

monoatomic cation channel activity [inference]

ligand-gated monoatomic cation channel activity [inference]

acetylcholine-gated monoatomic cation-selective channel activity

ligand-gated monoatomic ion channel activity [inference]

extracellular ligand-gated monoatomic ion channel activity [inference]

excitatory extracellular ligand-gated monoatomic ion channel activity [inference]

acetylcholine-gated monoatomic cation-selective channel activity

transmitter-gated monoatomic ion channel activity [inference]

transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential [inference]

acetylcholine-gated monoatomic cation-selective channel activity

ligand-gated monoatomic cation channel activity [inference]

acetylcholine-gated monoatomic cation-selective channel activity

gated channel activity [inference]

ligand-gated channel activity [inference]

ligand-gated monoatomic ion channel activity [inference]

extracellular ligand-gated monoatomic ion channel activity [inference]

excitatory extracellular ligand-gated monoatomic ion channel activity [inference]

acetylcholine-gated monoatomic cation-selective channel activity

transmitter-gated monoatomic ion channel activity [inference]

transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential [inference]

acetylcholine-gated monoatomic cation-selective channel activity

ligand-gated monoatomic cation channel activity [inference]

acetylcholine-gated monoatomic cation-selective channel activity

transmitter-gated channel activity [inference]

transmitter-gated monoatomic ion channel activity [inference]

transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential [inference]

acetylcholine-gated monoatomic cation-selective channel activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

acetylcholine binding

protein-containing complex binding

molecular transducer activity [inference]

signaling receptor activity [inference]

transmembrane signaling receptor activity [inference]

acetylcholine receptor activity

neurotransmitter receptor activity [inference]

transmitter-gated channel activity [inference]

transmitter-gated monoatomic ion channel activity [inference]

transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential [inference]

acetylcholine-gated monoatomic cation-selective channel activity

postsynaptic neurotransmitter receptor activity [inference]

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAARGSRRRALRLLLMVQLLAGRWRPAGAARGARGGLPELSSAAKHEDSLFRDLFEDYEKWVRPVEHLSDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKIIRVPSDSLWIPDIVLFDNADGRFEGASTKTVVRYNGTVTWTQPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDIILEDQDVDRTDFFDNGEWEIMSAMGSKGNRTDSCCWYPCITYSFVIKRLPLFYTLFLIIPCIGLSFLTVVVFYLPSNEGEKISLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLVFTMIFVTLSIMVTVFAINIHHRSSSTHNAMAPWVRKIFLHKLPKLLCMRSHADRYFTQREEAEKDGGPKSRNTLEAALDCIRYITRHVVKENDVREVVEDWKFIAQVLDRMFLWTFLLVSIIGTLGLFVPVIYKWANIIVPVHIGNTIK

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	Description	Source
155	N-linked (GlcNAc...) asparagine	UniProt
183	N-linked (GlcNAc...) asparagine	UniProt
229	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Highly calcium permeable nicotinic acetylcholine receptors	Mus musculus
Highly calcium permeable postsynaptic nicotinic acetylcholine receptors	Mus musculus