GlyCosmos Portal

Submissions

Complement component receptor 1-like protein

Summary

UniProt ID: Q2VPA4
Gene Symbol: CR1L
Gene ID: 1379
Organism: Homo sapiens (human)

External Links

Re-Glyco: Q2VPA4

Annotation

Keyword: Alternative splicing Cytoplasm Disulfide bond Glycoprotein Membrane Proteomics identification Reference proteome Repeat Secreted Signal Sushi

Gene Ontology (GO)

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
T cell mediated immunity	IBA	GO_REF
regulation of complement activation	IDA	PMID
regulation of complement activation	IEA	GO_REF
negative regulation of complement activation, classical pathway	IBA	GO_REF
regulation of complement-dependent cytotoxicity	IDA	PMID

GO Hierarchy

biological process

immune system process [inference]

immune effector process [inference]

leukocyte mediated immunity [inference]

lymphocyte mediated immunity [inference]

T cell mediated immunity

immune response [inference]

adaptive immune response [inference]

adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

T cell mediated immunity

response to stimulus [inference]

immune response [inference]

adaptive immune response [inference]

adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

T cell mediated immunity

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

negative regulation of immune system process [inference]

negative regulation of immune effector process [inference]

negative regulation of leukocyte mediated immunity [inference]

negative regulation of lymphocyte mediated immunity [inference]

negative regulation of B cell mediated immunity [inference]

negative regulation of immunoglobulin mediated immune response [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of complement activation, classical pathway

negative regulation of complement activation [inference]

negative regulation of complement activation, classical pathway

negative regulation of immune response [inference]

negative regulation of adaptive immune response [inference]

negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

negative regulation of B cell mediated immunity [inference]

negative regulation of immunoglobulin mediated immune response [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of complement activation, classical pathway

negative regulation of humoral immune response [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of complement activation, classical pathway

negative regulation of complement activation [inference]

negative regulation of complement activation, classical pathway

regulation of immune effector process [inference]

negative regulation of immune effector process [inference]

negative regulation of leukocyte mediated immunity [inference]

negative regulation of lymphocyte mediated immunity [inference]

negative regulation of B cell mediated immunity [inference]

negative regulation of immunoglobulin mediated immune response [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of complement activation, classical pathway

negative regulation of complement activation [inference]

negative regulation of complement activation, classical pathway

regulation of leukocyte mediated immunity [inference]

negative regulation of leukocyte mediated immunity [inference]

negative regulation of lymphocyte mediated immunity [inference]

negative regulation of B cell mediated immunity [inference]

negative regulation of immunoglobulin mediated immune response [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of complement activation, classical pathway

regulation of lymphocyte mediated immunity [inference]

negative regulation of lymphocyte mediated immunity [inference]

negative regulation of B cell mediated immunity [inference]

negative regulation of immunoglobulin mediated immune response [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of complement activation, classical pathway

regulation of B cell mediated immunity [inference]

negative regulation of B cell mediated immunity [inference]

negative regulation of immunoglobulin mediated immune response [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of complement activation, classical pathway

regulation of immunoglobulin mediated immune response [inference]

negative regulation of immunoglobulin mediated immune response [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of complement activation, classical pathway

regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of complement activation, classical pathway

regulation of complement activation, classical pathway [inference]

negative regulation of complement activation, classical pathway

regulation of complement activation

regulation of complement activation, classical pathway [inference]

negative regulation of complement activation, classical pathway

negative regulation of complement activation [inference]

negative regulation of complement activation, classical pathway

regulation of immune response [inference]

regulation of adaptive immune response [inference]

negative regulation of adaptive immune response [inference]

negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

negative regulation of B cell mediated immunity [inference]

negative regulation of immunoglobulin mediated immune response [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of complement activation, classical pathway

regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

regulation of B cell mediated immunity [inference]

negative regulation of B cell mediated immunity [inference]

negative regulation of immunoglobulin mediated immune response [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of complement activation, classical pathway

regulation of immunoglobulin mediated immune response [inference]

negative regulation of immunoglobulin mediated immune response [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of complement activation, classical pathway

regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of complement activation, classical pathway

regulation of complement activation, classical pathway [inference]

negative regulation of complement activation, classical pathway

negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

negative regulation of B cell mediated immunity [inference]

negative regulation of immunoglobulin mediated immune response [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of complement activation, classical pathway

regulation of humoral immune response [inference]

negative regulation of humoral immune response [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of complement activation, classical pathway

negative regulation of complement activation [inference]

negative regulation of complement activation, classical pathway

regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of complement activation, classical pathway

regulation of complement activation, classical pathway [inference]

negative regulation of complement activation, classical pathway

regulation of complement activation

regulation of complement activation, classical pathway [inference]

negative regulation of complement activation, classical pathway

negative regulation of complement activation [inference]

negative regulation of complement activation, classical pathway

negative regulation of immune response [inference]

negative regulation of adaptive immune response [inference]

negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

negative regulation of B cell mediated immunity [inference]

negative regulation of immunoglobulin mediated immune response [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of complement activation, classical pathway

negative regulation of humoral immune response [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of complement activation, classical pathway

negative regulation of complement activation [inference]

negative regulation of complement activation, classical pathway

negative regulation of biological process [inference]

negative regulation of immune system process [inference]

negative regulation of immune effector process [inference]

negative regulation of leukocyte mediated immunity [inference]

negative regulation of lymphocyte mediated immunity [inference]

negative regulation of B cell mediated immunity [inference]

negative regulation of immunoglobulin mediated immune response [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of complement activation, classical pathway

negative regulation of complement activation [inference]

negative regulation of complement activation, classical pathway

negative regulation of immune response [inference]

negative regulation of adaptive immune response [inference]

negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

negative regulation of B cell mediated immunity [inference]

negative regulation of immunoglobulin mediated immune response [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of complement activation, classical pathway

negative regulation of humoral immune response [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of complement activation, classical pathway

negative regulation of complement activation [inference]

negative regulation of complement activation, classical pathway

negative regulation of response to stimulus [inference]

negative regulation of immune response [inference]

negative regulation of adaptive immune response [inference]

negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

negative regulation of B cell mediated immunity [inference]

negative regulation of immunoglobulin mediated immune response [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of complement activation, classical pathway

negative regulation of humoral immune response [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of complement activation, classical pathway

negative regulation of complement activation [inference]

negative regulation of complement activation, classical pathway

regulation of response to stimulus [inference]

negative regulation of response to stimulus [inference]

negative regulation of immune response [inference]

negative regulation of adaptive immune response [inference]

negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

negative regulation of B cell mediated immunity [inference]

negative regulation of immunoglobulin mediated immune response [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of complement activation, classical pathway

negative regulation of humoral immune response [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of complement activation, classical pathway

negative regulation of complement activation [inference]

negative regulation of complement activation, classical pathway

regulation of immune response [inference]

regulation of adaptive immune response [inference]

negative regulation of adaptive immune response [inference]

negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

negative regulation of B cell mediated immunity [inference]

negative regulation of immunoglobulin mediated immune response [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of complement activation, classical pathway

regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

regulation of B cell mediated immunity [inference]

negative regulation of B cell mediated immunity [inference]

negative regulation of immunoglobulin mediated immune response [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of complement activation, classical pathway

regulation of immunoglobulin mediated immune response [inference]

negative regulation of immunoglobulin mediated immune response [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of complement activation, classical pathway

regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of complement activation, classical pathway

regulation of complement activation, classical pathway [inference]

negative regulation of complement activation, classical pathway

negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

negative regulation of B cell mediated immunity [inference]

negative regulation of immunoglobulin mediated immune response [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of complement activation, classical pathway

regulation of humoral immune response [inference]

negative regulation of humoral immune response [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of complement activation, classical pathway

negative regulation of complement activation [inference]

negative regulation of complement activation, classical pathway

regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of complement activation, classical pathway

regulation of complement activation, classical pathway [inference]

negative regulation of complement activation, classical pathway

regulation of complement activation

regulation of complement activation, classical pathway [inference]

negative regulation of complement activation, classical pathway

negative regulation of complement activation [inference]

negative regulation of complement activation, classical pathway

negative regulation of immune response [inference]

negative regulation of adaptive immune response [inference]

negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

negative regulation of B cell mediated immunity [inference]

negative regulation of immunoglobulin mediated immune response [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of complement activation, classical pathway

negative regulation of humoral immune response [inference]

negative regulation of humoral immune response mediated by circulating immunoglobulin [inference]

negative regulation of complement activation, classical pathway

negative regulation of complement activation [inference]

negative regulation of complement activation, classical pathway

regulation of cellular process [inference]

regulation of cell killing [inference]

regulation of complement-dependent cytotoxicity

Displaying **all 4** entries
GO Term	Evidence Code	Reference
obsolete extracellular space
cytoplasm	IEA	GO_REF
plasma membrane	IBA	GO_REF
signaling receptor complex	IDA	PMID

GO Hierarchy

cellular component

protein-containing complex [inference]

signaling receptor complex

cellular anatomical structure [inference]

cytoplasm

membrane [inference]

plasma membrane

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAPPVRLERPFPSRRFPGLLLAALVLLLSSFSDQCNVPEWLPFARPTNLTDDFEFPIGTYLNYECRPGYSGRPFSIICLKNSVWTSAKDKCKRKSCRNPPDPVNGMAHVIKDIQFRSQIKYSCPKGYRLIGSSSATCIISGNTVIWDNKTPVCDRIICGLPPTIANGDFTSISREYFHYGSVVTYHCNLGSRGKKVFELVGEPSIYCTSKDDQVGIWSGPAPQCIIPNKCTPPNVENGILVSDNRSLFSLNEVVEFRCQPGFGMKGPSHVKCQALNKWEPELPSCSRVCQPPPDVLHAERTQRDKDNFSPGQEVFYSCEPGYDLRGSTYLHCTPQGDWSPAAPRCEVKSCDDFLGQLPNGHVLFPLNLQLGAKVDFVCDEGFQLKGSSASYCVLAGMESLWNSSVPVCERKSCETPPVPVNGMVHVITDIHVGSRINYSCTTGHRLIGHSSAECILSGNTAHWSMKPPICQQIFCPNPPAILNGRHTGTPLGDIPYGKEVSYTCDPHPDRGMTFNLIGESTIRRTSEPHGNGVWSSPAPRCELPVGAGSHDALIVGKFYEVFAEEFCHL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites