GlyCosmos Portal

Submissions

5,6-dihydroxyindole-2-carboxylic acid oxidase

Summary

UniProt ID: Q2VPW6
Gene Symbol: TYRP1
Gene ID: 554339
Organism: Felis catus (domestic cat)

External Links

Re-Glyco: Q2VPW6

Annotation

Keyword: Alternative splicing Copper Disulfide bond Glycoprotein Melanin biosynthesis Metal-binding Monooxygenase Reference proteome Signal Transmembrane helix Zinc

Gene Ontology (GO)

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
melanocyte differentiation	IBA	GO_REF
melanocyte differentiation	IEA	GO_REF
melanosome organization	IBA	GO_REF
melanosome organization	IEA	GO_REF
melanin biosynthetic process	IEA	GO_REF GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

biosynthetic process [inference]

secondary metabolite biosynthetic process [inference]

melanin biosynthetic process

phenol-containing compound biosynthetic process [inference]

melanin biosynthetic process

phenol-containing compound metabolic process [inference]

melanin metabolic process [inference]

melanin biosynthetic process

phenol-containing compound biosynthetic process [inference]

melanin biosynthetic process

secondary metabolic process [inference]

melanin metabolic process [inference]

melanin biosynthetic process

secondary metabolite biosynthetic process [inference]

melanin biosynthetic process

pigment metabolic process [inference]

melanin metabolic process [inference]

melanin biosynthetic process

pigment biosynthetic process [inference]

melanin biosynthetic process

cellular developmental process [inference]

cell differentiation [inference]

pigment cell differentiation [inference]

melanocyte differentiation

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

vesicle organization [inference]

pigment granule organization [inference]

melanosome organization

developmental process [inference]

cellular developmental process [inference]

cell differentiation [inference]

pigment cell differentiation [inference]

melanocyte differentiation

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of secondary metabolite biosynthetic process [inference]

positive regulation of melanin biosynthetic process

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of secondary metabolite biosynthetic process [inference]

positive regulation of melanin biosynthetic process

regulation of secondary metabolite biosynthetic process [inference]

regulation of melanin biosynthetic process [inference]

positive regulation of melanin biosynthetic process

positive regulation of secondary metabolite biosynthetic process [inference]

positive regulation of melanin biosynthetic process

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of secondary metabolite biosynthetic process [inference]

positive regulation of melanin biosynthetic process

regulation of secondary metabolic process [inference]

regulation of secondary metabolite biosynthetic process [inference]

regulation of melanin biosynthetic process [inference]

positive regulation of melanin biosynthetic process

positive regulation of secondary metabolite biosynthetic process [inference]

positive regulation of melanin biosynthetic process

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of secondary metabolite biosynthetic process [inference]

positive regulation of melanin biosynthetic process

Displaying **all 4** entries
GO Term	Evidence Code	Reference
melanosome membrane	ISS	GO_REF
melanosome membrane	IEA	GO_REF
melanosome	IBA	GO_REF
melanosome	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

vesicle membrane [inference]

cytoplasmic vesicle membrane [inference]

pigment granule membrane [inference]

melanosome membrane

bounding membrane of organelle [inference]

pigment granule membrane [inference]

melanosome membrane

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

pigment granule [inference]

melanosome

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

pigment granule [inference]

melanosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

pigment granule [inference]

melanosome

Displaying **all 2** entries
GO Term	Evidence Code	Reference
tyrosinase activity	IBA	GO_REF
metal ion binding

GO Hierarchy

molecular function

catalytic activity [inference]

oxidoreductase activity [inference]

monooxygenase activity [inference]

oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, another compound as one donor, and incorporation of one atom of oxygen [inference]

tyrosinase activity

oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen [inference]

oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, another compound as one donor, and incorporation of one atom of oxygen [inference]

tyrosinase activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MKAHKFLSLGYIVLPLLCSPQTWAQFPRQCATVEALRNGVCCPDLSPLSGPGTDRCGSSSGRGRCEAVTADSRPHSLHYPHDGRDDREAWPTRFFNRTCRCNGNFSGHNCGTCRPGWKGAACDQRVLIVRRNLLDLSAEEKNHLVQALHLAKRTMHPQFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTFLGPGQESFGEVDFSHEGPAFLTWHRYHLLQLERDMQEMLQDPSFSLPYWNFATGKNICDICTDDLMGSRSNFDPTLISLNSVFSQWRVVCESLEDYDTLGTLCNSTEGGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSNSTNSFRNTVEGYSDPTGKYDPAIRSLHNLAHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNADVSTFPLENAPIGHNRQYNMVPFWPPVTNIEMFVTAPDNLGYTYEVQWPSRNFSISELVTIGVVAALSLVAVIFAGASCMIRARSNMDEAHQPLLTDQYQHYAEEYEKMHNPNQSMV

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 7** entries
Position	Description	Source
96	N-linked (GlcNAc...) asparagine	UniProt
104	N-linked (GlcNAc...) asparagine	UniProt
181	N-linked (GlcNAc...) asparagine	UniProt
304	N-linked (GlcNAc...) asparagine	UniProt
350	N-linked (GlcNAc...) asparagine	UniProt
385	N-linked (GlcNAc...) asparagine	UniProt
472	N-linked (GlcNAc...) asparagine	UniProt