GlyCosmos Portal

Submissions

Natural killer cells antigen CD94

Summary

UniProt ID: Q38HS3
Gene Symbol: CD94 KLRD1
Gene ID: 611360
Organism: Canis lupus familiaris (dog)

External Links

Re-Glyco: Q38HS3

Annotation

Keyword: Adaptive immunity Cell membrane Disulfide bond Glycoprotein Innate immunity Lectin Receptor Reference proteome Signal-anchor Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
negative regulation of T cell mediated cytotoxicity	ISS	GO_REF
stimulatory C-type lectin receptor signaling pathway	ISS	GO_REF
stimulatory C-type lectin receptor signaling pathway	IBA	GO_REF
stimulatory C-type lectin receptor signaling pathway	IEA	GO_REF
adaptive immune response

GO Hierarchy

biological process

immune system process [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

immune response [inference]

cellular process [inference]

signal transduction [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

cell surface receptor signaling pathway [inference]

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

immune response [inference]

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to lectin [inference]

cellular response to lectin [inference]

stimulatory C-type lectin receptor signaling pathway

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

negative regulation of immune system process [inference]

negative regulation of immune effector process [inference]

negative regulation of leukocyte mediated immunity [inference]

negative regulation of leukocyte mediated cytotoxicity [inference]

negative regulation of lymphocyte mediated immunity [inference]

negative regulation of T cell mediated immunity [inference]

negative regulation of T cell mediated cytotoxicity

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

negative regulation of immune response [inference]

negative regulation of adaptive immune response [inference]

negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

negative regulation of T cell mediated immunity [inference]

negative regulation of T cell mediated cytotoxicity

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

positive regulation of immune system process [inference]

positive regulation of immune effector process [inference]

positive regulation of leukocyte mediated immunity [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of natural killer cell mediated cytotoxicity

positive regulation of lymphocyte mediated immunity [inference]

positive regulation of natural killer cell mediated immunity [inference]

positive regulation of natural killer cell mediated cytotoxicity

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of natural killer cell mediated immunity [inference]

positive regulation of natural killer cell mediated cytotoxicity

regulation of immune effector process [inference]

negative regulation of immune effector process [inference]

negative regulation of leukocyte mediated immunity [inference]

negative regulation of leukocyte mediated cytotoxicity [inference]

negative regulation of lymphocyte mediated immunity [inference]

negative regulation of T cell mediated immunity [inference]

negative regulation of T cell mediated cytotoxicity

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

positive regulation of immune effector process [inference]

positive regulation of leukocyte mediated immunity [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of natural killer cell mediated cytotoxicity

positive regulation of lymphocyte mediated immunity [inference]

positive regulation of natural killer cell mediated immunity [inference]

positive regulation of natural killer cell mediated cytotoxicity

regulation of leukocyte mediated immunity [inference]

regulation of leukocyte mediated cytotoxicity [inference]

negative regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of natural killer cell mediated cytotoxicity

regulation of T cell mediated cytotoxicity [inference]

negative regulation of T cell mediated cytotoxicity

regulation of natural killer cell mediated cytotoxicity [inference]

negative regulation of leukocyte mediated immunity [inference]

negative regulation of leukocyte mediated cytotoxicity [inference]

negative regulation of lymphocyte mediated immunity [inference]

negative regulation of T cell mediated immunity [inference]

negative regulation of T cell mediated cytotoxicity

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

positive regulation of leukocyte mediated immunity [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of natural killer cell mediated cytotoxicity

positive regulation of lymphocyte mediated immunity [inference]

positive regulation of natural killer cell mediated immunity [inference]

positive regulation of natural killer cell mediated cytotoxicity

regulation of lymphocyte mediated immunity [inference]

negative regulation of lymphocyte mediated immunity [inference]

negative regulation of T cell mediated immunity [inference]

negative regulation of T cell mediated cytotoxicity

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

positive regulation of lymphocyte mediated immunity [inference]

positive regulation of natural killer cell mediated immunity [inference]

positive regulation of natural killer cell mediated cytotoxicity

regulation of T cell mediated immunity [inference]

regulation of T cell mediated cytotoxicity [inference]

negative regulation of T cell mediated cytotoxicity

negative regulation of T cell mediated immunity [inference]

negative regulation of T cell mediated cytotoxicity

regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

positive regulation of natural killer cell mediated immunity [inference]

positive regulation of natural killer cell mediated cytotoxicity

regulation of natural killer cell mediated cytotoxicity [inference]

regulation of immune response [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

regulation of adaptive immune response [inference]

negative regulation of adaptive immune response [inference]

negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

negative regulation of T cell mediated immunity [inference]

negative regulation of T cell mediated cytotoxicity

regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

regulation of T cell mediated immunity [inference]

regulation of T cell mediated cytotoxicity [inference]

negative regulation of T cell mediated cytotoxicity

negative regulation of T cell mediated immunity [inference]

negative regulation of T cell mediated cytotoxicity

negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

negative regulation of T cell mediated immunity [inference]

negative regulation of T cell mediated cytotoxicity

regulation of innate immune response [inference]

regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

positive regulation of natural killer cell mediated immunity [inference]

positive regulation of natural killer cell mediated cytotoxicity

regulation of natural killer cell mediated cytotoxicity [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of natural killer cell mediated immunity [inference]

positive regulation of natural killer cell mediated cytotoxicity

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

negative regulation of immune response [inference]

negative regulation of adaptive immune response [inference]

negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

negative regulation of T cell mediated immunity [inference]

negative regulation of T cell mediated cytotoxicity

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of natural killer cell mediated immunity [inference]

positive regulation of natural killer cell mediated cytotoxicity

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of immune effector process [inference]

positive regulation of leukocyte mediated immunity [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of natural killer cell mediated cytotoxicity

positive regulation of lymphocyte mediated immunity [inference]

positive regulation of natural killer cell mediated immunity [inference]

positive regulation of natural killer cell mediated cytotoxicity

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of natural killer cell mediated immunity [inference]

positive regulation of natural killer cell mediated cytotoxicity

positive regulation of cellular process [inference]

positive regulation of cell killing [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of natural killer cell mediated cytotoxicity

positive regulation of response to stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of natural killer cell mediated immunity [inference]

positive regulation of natural killer cell mediated cytotoxicity

positive regulation of defense response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of natural killer cell mediated immunity [inference]

positive regulation of natural killer cell mediated cytotoxicity

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of natural killer cell mediated immunity [inference]

positive regulation of natural killer cell mediated cytotoxicity

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of natural killer cell mediated immunity [inference]

positive regulation of natural killer cell mediated cytotoxicity

negative regulation of biological process [inference]

negative regulation of immune system process [inference]

negative regulation of immune effector process [inference]

negative regulation of leukocyte mediated immunity [inference]

negative regulation of leukocyte mediated cytotoxicity [inference]

negative regulation of lymphocyte mediated immunity [inference]

negative regulation of T cell mediated immunity [inference]

negative regulation of T cell mediated cytotoxicity

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

negative regulation of immune response [inference]

negative regulation of adaptive immune response [inference]

negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

negative regulation of T cell mediated immunity [inference]

negative regulation of T cell mediated cytotoxicity

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

negative regulation of cellular process [inference]

negative regulation of cell killing [inference]

negative regulation of leukocyte mediated cytotoxicity [inference]

negative regulation of response to stimulus [inference]

negative regulation of response to biotic stimulus [inference]

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

negative regulation of defense response [inference]

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

negative regulation of response to external stimulus [inference]

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

negative regulation of immune response [inference]

negative regulation of adaptive immune response [inference]

negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

negative regulation of T cell mediated immunity [inference]

negative regulation of T cell mediated cytotoxicity

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

regulation of response to stimulus [inference]

regulation of response to biotic stimulus [inference]

negative regulation of response to biotic stimulus [inference]

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of natural killer cell mediated immunity [inference]

positive regulation of natural killer cell mediated cytotoxicity

regulation of innate immune response [inference]

regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

positive regulation of natural killer cell mediated immunity [inference]

positive regulation of natural killer cell mediated cytotoxicity

regulation of natural killer cell mediated cytotoxicity [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of natural killer cell mediated immunity [inference]

positive regulation of natural killer cell mediated cytotoxicity

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

regulation of response to external stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of natural killer cell mediated immunity [inference]

positive regulation of natural killer cell mediated cytotoxicity

regulation of innate immune response [inference]

regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

positive regulation of natural killer cell mediated immunity [inference]

positive regulation of natural killer cell mediated cytotoxicity

regulation of natural killer cell mediated cytotoxicity [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of natural killer cell mediated immunity [inference]

positive regulation of natural killer cell mediated cytotoxicity

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

positive regulation of response to stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of natural killer cell mediated immunity [inference]

positive regulation of natural killer cell mediated cytotoxicity

positive regulation of defense response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of natural killer cell mediated immunity [inference]

positive regulation of natural killer cell mediated cytotoxicity

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of natural killer cell mediated immunity [inference]

positive regulation of natural killer cell mediated cytotoxicity

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of natural killer cell mediated immunity [inference]

positive regulation of natural killer cell mediated cytotoxicity

negative regulation of response to stimulus [inference]

negative regulation of response to biotic stimulus [inference]

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

negative regulation of defense response [inference]

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

negative regulation of response to external stimulus [inference]

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

negative regulation of immune response [inference]

negative regulation of adaptive immune response [inference]

negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

negative regulation of T cell mediated immunity [inference]

negative regulation of T cell mediated cytotoxicity

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

regulation of immune response [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

regulation of adaptive immune response [inference]

negative regulation of adaptive immune response [inference]

negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

negative regulation of T cell mediated immunity [inference]

negative regulation of T cell mediated cytotoxicity

regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

regulation of T cell mediated immunity [inference]

regulation of T cell mediated cytotoxicity [inference]

negative regulation of T cell mediated cytotoxicity

negative regulation of T cell mediated immunity [inference]

negative regulation of T cell mediated cytotoxicity

negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

negative regulation of T cell mediated immunity [inference]

negative regulation of T cell mediated cytotoxicity

regulation of innate immune response [inference]

regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

positive regulation of natural killer cell mediated immunity [inference]

positive regulation of natural killer cell mediated cytotoxicity

regulation of natural killer cell mediated cytotoxicity [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of natural killer cell mediated immunity [inference]

positive regulation of natural killer cell mediated cytotoxicity

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

negative regulation of immune response [inference]

negative regulation of adaptive immune response [inference]

negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

negative regulation of T cell mediated immunity [inference]

negative regulation of T cell mediated cytotoxicity

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of natural killer cell mediated immunity [inference]

positive regulation of natural killer cell mediated cytotoxicity

regulation of response to stress [inference]

regulation of defense response [inference]

negative regulation of defense response [inference]

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

positive regulation of defense response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of natural killer cell mediated immunity [inference]

positive regulation of natural killer cell mediated cytotoxicity

regulation of innate immune response [inference]

regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

positive regulation of natural killer cell mediated immunity [inference]

positive regulation of natural killer cell mediated cytotoxicity

regulation of natural killer cell mediated cytotoxicity [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

positive regulation of natural killer cell mediated immunity [inference]

positive regulation of natural killer cell mediated cytotoxicity

negative regulation of innate immune response [inference]

negative regulation of natural killer cell mediated immunity [inference]

negative regulation of natural killer cell mediated cytotoxicity

regulation of cellular process [inference]

signal transduction [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

innate immune response-activating signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

cell surface receptor signaling pathway [inference]

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

innate immune response activating cell surface receptor signaling pathway [inference]

stimulatory C-type lectin receptor signaling pathway

regulation of cell killing [inference]

regulation of leukocyte mediated cytotoxicity [inference]

negative regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of natural killer cell mediated cytotoxicity

regulation of T cell mediated cytotoxicity [inference]

negative regulation of T cell mediated cytotoxicity

regulation of natural killer cell mediated cytotoxicity [inference]

negative regulation of cell killing [inference]

negative regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of cell killing [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of natural killer cell mediated cytotoxicity

positive regulation of cellular process [inference]

positive regulation of cell killing [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of natural killer cell mediated cytotoxicity

negative regulation of cellular process [inference]

negative regulation of cell killing [inference]

negative regulation of leukocyte mediated cytotoxicity [inference]

Displaying **all 4** entries
GO Term	Evidence Code	Reference
plasma membrane	ISS	GO_REF
plasma membrane	IBA	GO_REF
plasma membrane	IEA	GO_REF
external side of plasma membrane

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

side of membrane [inference]

external side of plasma membrane

Displaying **all 2** entries
GO Term	Evidence Code	Reference
transmembrane signaling receptor activity
carbohydrate binding

GO Hierarchy

molecular function

binding [inference]

carbohydrate binding

molecular transducer activity [inference]

signaling receptor activity [inference]

transmembrane signaling receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAVSQTTLWNLISGILGVICLLLMTTMGILLKNLLLTESIQPTLSPGPITELQKGSDCCSCPKRWIGHQCNCYLFFDELKSWTESRDFCASQNSSLLHIQNRDELRFVSSSKYFYWIGVYYSKENGTWLWENGLALPQDLLQTIQTFDTKKCVIYSSSHSVLDVSCEDKSRFICKQELM

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
93	N-linked (GlcNAc...) asparagine			UniProt
125	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
DAP12 interactions	Canis familiaris
DAP12 signaling	Canis familiaris

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements