GlyCosmos Portal

Submissions

Neutral amino acid transporter 9

Summary

UniProt ID: Q3B8Q3
Gene Symbol: Slc38a9
Gene ID: 310091
Organism: Rattus norvegicus (Norway rat)

External Links

PubChem: Q3B8Q3
Re-Glyco: Q3B8Q3

Annotation

Keyword: Amino-acid transport Disulfide bond Endosome Glycoprotein Lysosome Metal-binding Reference proteome Sodium Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 16 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
amino acid transmembrane transport	ISS	GO_REF
amino acid transmembrane transport	ISO	GO_REF
amino acid transmembrane transport	IBA	GO_REF
asparagine transport	ISS	GO_REF
asparagine transport	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to acid chemical [inference]

cellular response to amino acid stimulus

transmembrane transport [inference]

amino acid transmembrane transport

L-alpha-amino acid transmembrane transport [inference]

L-arginine transmembrane transport

basic amino acid transmembrane transport [inference]

L-arginine transmembrane transport

carboxylic acid transmembrane transport [inference]

L-alpha-amino acid transmembrane transport [inference]

L-arginine transmembrane transport

response to stimulus [inference]

response to chemical [inference]

response to acid chemical [inference]

response to amino acid [inference]

cellular response to amino acid stimulus

cellular response to acid chemical [inference]

cellular response to amino acid stimulus

cellular response to chemical stimulus [inference]

cellular response to acid chemical [inference]

cellular response to amino acid stimulus

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to acid chemical [inference]

cellular response to amino acid stimulus

localization [inference]

establishment of localization [inference]

transport [inference]

amino acid transport [inference]

amino acid transmembrane transport

L-alpha-amino acid transmembrane transport [inference]

L-arginine transmembrane transport

basic amino acid transmembrane transport [inference]

L-arginine transmembrane transport

basic amino acid transport [inference]

basic amino acid transmembrane transport [inference]

L-arginine transmembrane transport

neutral amino acid transport [inference]

L-amino acid transport [inference]

L-glutamine transport

L-alpha-amino acid transmembrane transport [inference]

L-arginine transmembrane transport

organic cation transport [inference]

organic anion transport [inference]

carboxylic acid transport [inference]

asparagine transport

L-amino acid transport [inference]

L-glutamine transport

L-alpha-amino acid transmembrane transport [inference]

L-arginine transmembrane transport

carboxylic acid transmembrane transport [inference]

L-alpha-amino acid transmembrane transport [inference]

L-arginine transmembrane transport

organic acid transport [inference]

carboxylic acid transport [inference]

asparagine transport

L-amino acid transport [inference]

L-glutamine transport

L-alpha-amino acid transmembrane transport [inference]

L-arginine transmembrane transport

carboxylic acid transmembrane transport [inference]

L-alpha-amino acid transmembrane transport [inference]

L-arginine transmembrane transport

transmembrane transport [inference]

amino acid transmembrane transport

L-alpha-amino acid transmembrane transport [inference]

L-arginine transmembrane transport

basic amino acid transmembrane transport [inference]

L-arginine transmembrane transport

carboxylic acid transmembrane transport [inference]

L-alpha-amino acid transmembrane transport [inference]

L-arginine transmembrane transport

nitrogen compound transport [inference]

asparagine transport

L-amino acid transport [inference]

L-glutamine transport

L-alpha-amino acid transmembrane transport [inference]

L-arginine transmembrane transport

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of TOR signaling

positive regulation of TORC1 signaling

regulation of intracellular signal transduction [inference]

regulation of TOR signaling [inference]

positive regulation of TOR signaling

positive regulation of TORC1 signaling

regulation of TORC1 signaling [inference]

positive regulation of TORC1 signaling

positive regulation of intracellular signal transduction [inference]

positive regulation of TOR signaling

positive regulation of TORC1 signaling

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of TOR signaling

positive regulation of TORC1 signaling

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of TOR signaling

positive regulation of TORC1 signaling

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of TOR signaling

positive regulation of TORC1 signaling

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of TOR signaling

positive regulation of TORC1 signaling

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of TOR signaling

positive regulation of TORC1 signaling

regulation of intracellular signal transduction [inference]

regulation of TOR signaling [inference]

positive regulation of TOR signaling

positive regulation of TORC1 signaling

regulation of TORC1 signaling [inference]

positive regulation of TORC1 signaling

positive regulation of intracellular signal transduction [inference]

positive regulation of TOR signaling

positive regulation of TORC1 signaling

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of TOR signaling

positive regulation of TORC1 signaling

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of TOR signaling

positive regulation of TORC1 signaling

regulation of intracellular signal transduction [inference]

regulation of TOR signaling [inference]

positive regulation of TOR signaling

positive regulation of TORC1 signaling

regulation of TORC1 signaling [inference]

positive regulation of TORC1 signaling

positive regulation of intracellular signal transduction [inference]

positive regulation of TOR signaling

positive regulation of TORC1 signaling

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of TOR signaling

positive regulation of TORC1 signaling

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of TOR signaling

positive regulation of TORC1 signaling

Displaying entries **1 - 5** of 14 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
lysosome	ISS	GO_REF
lysosome	ISO	GO_REF
lysosomal membrane	ISS	GO_REF
lysosomal membrane	ISO	GO_REF
lysosomal membrane	IBA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

membrane protein complex [inference]

Ragulator complex

intracellular protein-containing complex [inference]

guanyl-nucleotide exchange factor complex [inference]

Ragulator complex

enzyme activator complex [inference]

GTPase activator complex [inference]

FNIP-folliculin RagC/D GAP

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

vesicle membrane [inference]

cytoplasmic vesicle membrane [inference]

endosome membrane [inference]

late endosome membrane

bounding membrane of organelle [inference]

vacuolar membrane [inference]

lytic vacuole membrane [inference]

lysosomal membrane

endosome membrane [inference]

late endosome membrane

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

late endosome

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

late endosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

late endosome

Displaying entries **1 - 5** of 21 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
guanyl-nucleotide exchange factor activity	ISS	GO_REF
guanyl-nucleotide exchange factor activity	ISO	GO_REF
monoatomic cation transmembrane transporter activity	IEA	GO_REF
amino acid transmembrane transporter activity	ISS	GO_REF
amino acid transmembrane transporter activity	ISO	GO_REF

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity [inference]

monoatomic ion transmembrane transporter activity [inference]

monoatomic cation transmembrane transporter activity

amino acid transmembrane transporter activity

basic amino acid transmembrane transporter activity [inference]

L-arginine transmembrane transporter activity

neutral L-amino acid transmembrane transporter activity [inference]

L-amino acid transmembrane transporter activity

active transmembrane transporter activity [inference]

secondary active transmembrane transporter activity

carboxylic acid transmembrane transporter activity [inference]

L-amino acid transmembrane transporter activity

branched-chain amino acid transmembrane transporter activity [inference]

L-leucine transmembrane transporter activity

binding [inference]

lipid binding [inference]

steroid binding [inference]

sterol binding [inference]

cholesterol binding

amino acid binding [inference]

arginine binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

carboxylic acid binding [inference]

arginine binding

cation binding [inference]

organic acid binding [inference]

carboxylic acid binding [inference]

arginine binding

alcohol binding [inference]

cholesterol binding

molecular function regulator activity [inference]

enzyme regulator activity [inference]

nucleoside-triphosphatase regulator activity [inference]

GTPase regulator activity [inference]

guanyl-nucleotide exchange factor activity

molecular sensor activity [inference]

lipid sensor activity [inference]

sterol sensor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MANVDSDSRHLISEVEHEVNPGPMNIQFDSSDLRSKRPFYIEPTNIVNVNDVIQKVSDHAAAMNKRIHYYSRLTTPADKALIAPDHVVPAPEECYVYSPLGSAYKLKSYTEGYRKNTSLVTIFMIWNTMMGTSILSIPWGIKQAGFTTGMCVIVLMGLLTLYCCYRVVKSRSMIVTSDTTTWEYPDVCKHYFGSFGQWSSLLFSLVSLIGAMIVYWVLMSNFLFNTGKFIFNFIHHINDTDTVLSTNNSSPVICPSAGSGHPDNSSMIFYNSDTEVRLFERWWDKSKTVPFYLIGLLLPLLNFKSPSFFSKFNILGTVSVLYLIFIVTLKAIRLGFHLEFHWFAPTEFFVPEIRAQFPQLTGVLTLAFFIHNCIITLLKNNKNQENNVRDLCIAYMLVTLTYLYIGVLVFASFPSPPLPKDCIEQNFLDNFPSSDTLSFIARICLLFQMMTVYPLLGYLARVQLLGHIFGDIYPSIFHVLILNLIIVGAGVTMACFYPNIGGIIRYSGAACGLAFVFIYPSLIYILSQHQEERLTWPKLVFHIIIIILGLANLIAQFFM

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	Description	Source
238	N-linked (GlcNAc...) asparagine	UniProt
247	N-linked (GlcNAc...) asparagine	UniProt
264	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 7** entries
Pathway Name	Organism
Amino acids regulate mTORC1	Rattus norvegicus
Energy dependent regulation of mTOR by LKB1-AMPK	Rattus norvegicus
MTOR signalling	Rattus norvegicus
Macroautophagy	Rattus norvegicus
Regulation of PTEN gene transcription	Rattus norvegicus
TP53 Regulates Metabolic Genes	Rattus norvegicus
mTORC1-mediated signalling	Rattus norvegicus