GlyCosmos Portal

Submissions

Signal peptide peptidase-like 2B

Summary

UniProt ID: Q3TD49
Gene Symbol: Sppl2b
Gene ID: 73218
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0004205
GlyGen: Q3TD49
PubChem: Q3TD49
Re-Glyco: Q3TD49

Annotation

Keyword: Alternative splicing Cell membrane Endosome Glycoprotein Golgi apparatus Lysosome Protease Reference proteome Signal Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
membrane protein ectodomain proteolysis	ISS	GO_REF
membrane protein ectodomain proteolysis	ISO	GO_REF
membrane protein ectodomain proteolysis	IEA	GO_REF
membrane protein intracellular domain proteolysis	ISS	GO_REF
membrane protein intracellular domain proteolysis	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

macromolecule metabolic process [inference]

protein metabolic process [inference]

proteolysis [inference]

membrane protein proteolysis

primary metabolic process [inference]

protein metabolic process [inference]

proteolysis [inference]

membrane protein proteolysis

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

regulation of immune response

regulation of response to stimulus [inference]

regulation of immune response

Displaying entries **1 - 5** of 31 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
Golgi membrane	ISS	GO_REF
Golgi membrane	IEA	GO_REF
nucleoplasm	ISO	GO_REF
lysosomal membrane	ISS	GO_REF
lysosomal membrane	ISO	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

nucleoplasm

microtubule organizing center [inference]

centrosome

membrane

plasma membrane

organelle membrane [inference]

vesicle membrane [inference]

cytoplasmic vesicle membrane [inference]

bounding membrane of organelle [inference]

Golgi membrane

vacuolar membrane [inference]

lytic vacuole membrane [inference]

lysosomal membrane

organelle [inference]

membraneless organelle [inference]

intracellular membraneless organelle [inference]

cytoskeleton [inference]

actin cytoskeleton

intracellular organelle [inference]

intracellular membraneless organelle [inference]

cytoskeleton [inference]

actin cytoskeleton

side of membrane [inference]

cytoplasmic side of membrane [inference]

cytoplasmic side of endoplasmic reticulum membrane

lumenal side of membrane [inference]

lumenal side of endoplasmic reticulum membrane

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
aspartic endopeptidase activity, intramembrane cleaving	ISS	GO_REF
aspartic endopeptidase activity, intramembrane cleaving	ISO	GO_REF
aspartic endopeptidase activity, intramembrane cleaving	IBA	GO_REF
protein homodimerization activity	ISS	GO_REF
protein homodimerization activity	ISO	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

peptidase activity [inference]

endopeptidase activity [inference]

aspartic-type endopeptidase activity [inference]

aspartic endopeptidase activity, intramembrane cleaving

aspartic-type peptidase activity [inference]

aspartic-type endopeptidase activity [inference]

aspartic endopeptidase activity, intramembrane cleaving

catalytic activity, acting on a protein [inference]

peptidase activity [inference]

endopeptidase activity [inference]

aspartic-type endopeptidase activity [inference]

aspartic endopeptidase activity, intramembrane cleaving

aspartic-type peptidase activity [inference]

aspartic-type endopeptidase activity [inference]

aspartic endopeptidase activity, intramembrane cleaving

binding [inference]

protein binding [inference]

identical protein binding [inference]

protein homodimerization activity

protein dimerization activity [inference]

protein homodimerization activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAAARLAAALLLLAAQVACEFGVLRVVSQTSRTRSRDYCILYNPQWAHLPHDLSKVSLLKLRDLSTTQLCSYLDVPAEDFTNQIALVARGNCTFYEKVRLAQGSGAHGLLIVSKEKLVPPGGNKTQYEEISIPVALLSHRDLQDIFRRFGREVMVALYAPSEPVMDYNMVIIFVMAVGTVAIGGYWAGSHDVKKYMKHKRDDGPEKQEDEAVDVTPVMICVFVVMCCFMLVLLYYFYDRLVYVIIGIFCLASSTGLYSCLAPFVRKLPFCTCRVPDNNLPYFHKRPQARMLLLALFCVTVSVVWGIFRNEDQWAWVLQDTLGIAFCLYMLKTIRLPTFKACTLLLLVLFIYDIFFVFITPFLTKSGNSIMVEVATGPSNSSTHEKLPMVLKVPRLNTSPLSLCDRPFSLLGFGDILVPGLLVAYCHRFDIQVQSSRIYFVACTIAYGLGLLVTFVALVLMQRGQPALLYLVPCTLLTSCTVALWRRELGAFWTGSGFAKDAPQTPWAATQGPVPPKAVGSSLSEQPPSEELAKSPLSTEEAGAADPAKDPDNPVASPLSPSNGDEAQPIPVVKPETSA

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	GlyTouCan ID	Source
91	N-linked (GlcNAc...) asparagine	G80920RR	GlycoProtDB UniProt GlyGen
123	N-linked (GlcNAc...) asparagine	G80920RR	UniProt GlyGen
379		G80920RR	GlycoProtDB GlyGen
396		G80920RR	GlyGen