GlyCosmos Portal

Submissions

Dual specificity mitogen-activated protein kinase kinase 1

Summary

UniProt ID

Q3TMJ8

Gene Symbol

Map2k1
Mek1
Prkmk1

Gene ID

[26395]

Organism

Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0004290
Re-Glyco: Q3TMJ8

Annotation

Keyword: ATP-binding Cytoskeleton Nucleus Phosphoprotein Serine/threonine-protein kinase Tyrosine-protein kinase

Gene Ontology (GO)

Displaying entries **1 - 5** of 37 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
regulation of vascular associated smooth muscle contraction	IEA	GO_REF
response to oxidative stress	IEA	GO_REF
negative regulation of cell population proliferation	IEA	GO_REF
positive regulation of autophagy	IEA	GO_REF
positive regulation of gene expression	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

microtubule-based process [inference]

microtubule-based movement [inference]

transport along microtubule [inference]

organelle transport along microtubule [inference]

vesicle transport along microtubule

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

ERBB signaling pathway [inference]

ERBB2 signaling pathway [inference]

ERBB2-ERBB3 signaling pathway

ERBB3 signaling pathway [inference]

ERBB2-ERBB3 signaling pathway

insulin-like growth factor receptor signaling pathway

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

MAPK cascade [inference]

ERK1 and ERK2 cascade

ensheathment of neurons [inference]

axon ensheathment [inference]

myelination

cell population proliferation [inference]

epithelial cell proliferation [inference]

epithelial cell proliferation involved in lung morphogenesis

cellular developmental process [inference]

cell development [inference]

glial cell development [inference]

Schwann cell development

cellular localization [inference]

intracellular transport [inference]

cytoskeleton-dependent intracellular transport [inference]

transport along microtubule [inference]

organelle transport along microtubule [inference]

vesicle transport along microtubule

vesicle cytoskeletal trafficking [inference]

vesicle transport along microtubule

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

Golgi organization [inference]

Golgi inheritance

organelle inheritance [inference]

Golgi inheritance

cell projection organization [inference]

cell projection morphogenesis [inference]

plasma membrane bounded cell projection morphogenesis [inference]

neuron projection morphogenesis

cellular senescence

multicellular organismal process [inference]

system process [inference]

circulatory system process [inference]

vascular process in circulatory system [inference]

blood vessel diameter maintenance [inference]

regulation of vasoconstriction [inference]

regulation of vascular associated smooth muscle contraction

developmental process [inference]

anatomical structure morphogenesis [inference]

cell projection morphogenesis [inference]

plasma membrane bounded cell projection morphogenesis [inference]

neuron projection morphogenesis

anatomical structure formation involved in morphogenesis [inference]

animal organ formation [inference]

trachea formation

anatomical structure development [inference]

cell development [inference]

glial cell development [inference]

Schwann cell development

animal organ development [inference]

hematopoietic or lymphoid organ development [inference]

thymus development

gland development [inference]

cellular developmental process [inference]

cell development [inference]

glial cell development [inference]

Schwann cell development

homeostatic process [inference]

chemical homeostasis [inference]

lipid homeostasis [inference]

acylglycerol homeostasis [inference]

triglyceride homeostasis

response to stimulus [inference]

response to stress [inference]

response to oxidative stress

response to wounding [inference]

response to axon injury

response to endogenous stimulus [inference]

response to hormone [inference]

response to steroid hormone [inference]

response to corticosteroid [inference]

response to glucocorticoid

response to chemical [inference]

response to hormone [inference]

response to steroid hormone [inference]

response to corticosteroid [inference]

response to glucocorticoid

response to lipid [inference]

response to steroid hormone [inference]

response to corticosteroid [inference]

response to glucocorticoid

localization [inference]

establishment of localization [inference]

transport [inference]

intracellular transport [inference]

cytoskeleton-dependent intracellular transport [inference]

transport along microtubule [inference]

organelle transport along microtubule [inference]

vesicle transport along microtubule

vesicle cytoskeletal trafficking [inference]

vesicle transport along microtubule

pigment granule transport [inference]

melanosome transport

microtubule-based transport [inference]

transport along microtubule [inference]

organelle transport along microtubule [inference]

vesicle transport along microtubule

establishment of localization in cell [inference]

intracellular transport [inference]

cytoskeleton-dependent intracellular transport [inference]

transport along microtubule [inference]

organelle transport along microtubule [inference]

vesicle transport along microtubule

vesicle cytoskeletal trafficking [inference]

vesicle transport along microtubule

establishment of vesicle localization [inference]

establishment of pigment granule localization [inference]

establishment of melanosome localization [inference]

melanosome transport

pigment granule transport [inference]

melanosome transport

vesicle cytoskeletal trafficking [inference]

vesicle transport along microtubule

establishment of organelle localization [inference]

establishment of vesicle localization [inference]

establishment of pigment granule localization [inference]

establishment of melanosome localization [inference]

melanosome transport

pigment granule transport [inference]

melanosome transport

vesicle cytoskeletal trafficking [inference]

vesicle transport along microtubule

organelle transport along microtubule [inference]

vesicle transport along microtubule

organelle localization [inference]

vesicle localization [inference]

establishment of vesicle localization [inference]

establishment of pigment granule localization [inference]

establishment of melanosome localization [inference]

melanosome transport

pigment granule transport [inference]

melanosome transport

vesicle cytoskeletal trafficking [inference]

vesicle transport along microtubule

pigment granule localization [inference]

melanosome localization [inference]

melanosome transport

pigment granule transport [inference]

melanosome transport

establishment of organelle localization [inference]

establishment of vesicle localization [inference]

establishment of pigment granule localization [inference]

establishment of melanosome localization [inference]

melanosome transport

pigment granule transport [inference]

melanosome transport

vesicle cytoskeletal trafficking [inference]

vesicle transport along microtubule

organelle transport along microtubule [inference]

vesicle transport along microtubule

cellular localization [inference]

intracellular transport [inference]

cytoskeleton-dependent intracellular transport [inference]

transport along microtubule [inference]

organelle transport along microtubule [inference]

vesicle transport along microtubule

vesicle cytoskeletal trafficking [inference]

vesicle transport along microtubule

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

regulation of stress-activated MAPK cascade

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of small GTPase mediated signal transduction [inference]

regulation of Ras protein signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

regulation of stress-activated protein kinase signaling cascade [inference]

regulation of stress-activated MAPK cascade

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of hypoxia-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of hypoxia-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

regulation of localization [inference]

regulation of protein localization [inference]

regulation of protein localization to synapse [inference]

regulation of neurotransmitter receptor localization to postsynaptic specialization membrane

regulation of protein localization to cell periphery [inference]

regulation of neurotransmitter receptor localization to postsynaptic specialization membrane

regulation of protein localization to membrane [inference]

regulation of neurotransmitter receptor localization to postsynaptic specialization membrane

regulation of transport [inference]

regulation of intracellular transport [inference]

regulation of early endosome to late endosome transport

regulation of vesicle-mediated transport [inference]

regulation of early endosome to late endosome transport

regulation of cellular localization [inference]

regulation of intracellular transport [inference]

regulation of early endosome to late endosome transport

regulation of protein localization to membrane [inference]

regulation of neurotransmitter receptor localization to postsynaptic specialization membrane

regulation of receptor localization to synapse [inference]

regulation of neurotransmitter receptor localization to postsynaptic specialization membrane

regulation of locomotion [inference]

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

positive regulation of cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of nucleotide biosynthetic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of catabolic process [inference]

positive regulation of autophagy

positive regulation of phosphorus metabolic process [inference]

positive regulation of phosphate metabolic process [inference]

positive regulation of nucleotide metabolic process [inference]

positive regulation of nucleotide biosynthetic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of purine nucleotide metabolic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of ATP metabolic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of small molecule metabolic process [inference]

positive regulation of nucleotide metabolic process [inference]

positive regulation of nucleotide biosynthetic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of purine nucleotide metabolic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of ATP metabolic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of axonogenesis

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis

positive regulation of multicellular organismal process [inference]

positive regulation of muscle contraction

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of homotypic cell-cell adhesion

negative regulation of cell population proliferation

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

negative regulation of cellular response to hypoxia [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

negative regulation of cellular response to hypoxia [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

regulation of stress-activated MAPK cascade

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of small GTPase mediated signal transduction [inference]

regulation of Ras protein signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

regulation of stress-activated protein kinase signaling cascade [inference]

regulation of stress-activated MAPK cascade

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of hypoxia-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of hypoxia-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

regulation of response to external stimulus [inference]

regulation of axon regeneration

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

negative regulation of cellular response to hypoxia [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

regulation of response to stress [inference]

regulation of cellular response to stress [inference]

regulation of stress-activated protein kinase signaling cascade [inference]

regulation of stress-activated MAPK cascade

regulation of neuron projection regeneration [inference]

regulation of axon regeneration

regulation of cellular response to hypoxia [inference]

negative regulation of cellular response to hypoxia [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

regulation of response to wounding [inference]

regulation of axon regeneration

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of axonogenesis [inference]

positive regulation of axonogenesis

regulation of cell differentiation [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis

regulation of cell development [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis

regulation of neurogenesis [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis

regulation of neuron projection regeneration [inference]

regulation of axon regeneration

regulation of multicellular organismal development [inference]

regulation of nervous system development [inference]

regulation of neurogenesis [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

ERBB signaling pathway [inference]

ERBB2 signaling pathway [inference]

ERBB2-ERBB3 signaling pathway

ERBB3 signaling pathway [inference]

ERBB2-ERBB3 signaling pathway

insulin-like growth factor receptor signaling pathway

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

MAPK cascade [inference]

ERK1 and ERK2 cascade

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

regulation of stress-activated MAPK cascade

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of small GTPase mediated signal transduction [inference]

regulation of Ras protein signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

regulation of stress-activated protein kinase signaling cascade [inference]

regulation of stress-activated MAPK cascade

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of hypoxia-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of hypoxia-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of nucleotide biosynthetic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

regulation of DNA-templated transcription elongation [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

regulation of transcription elongation by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

regulation of DNA-templated transcription elongation [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

regulation of transcription elongation by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

regulation of nucleotide biosynthetic process [inference]

positive regulation of nucleotide biosynthetic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

regulation of purine nucleotide biosynthetic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

regulation of ATP biosynthetic process [inference]

positive regulation of ATP biosynthetic process

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of nucleotide biosynthetic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of catabolic process [inference]

positive regulation of autophagy

positive regulation of phosphorus metabolic process [inference]

positive regulation of phosphate metabolic process [inference]

positive regulation of nucleotide metabolic process [inference]

positive regulation of nucleotide biosynthetic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of purine nucleotide metabolic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of ATP metabolic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of small molecule metabolic process [inference]

positive regulation of nucleotide metabolic process [inference]

positive regulation of nucleotide biosynthetic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of purine nucleotide metabolic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of ATP metabolic process [inference]

positive regulation of ATP biosynthetic process

regulation of catabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of autophagy

regulation of autophagy [inference]

positive regulation of autophagy

regulation of phosphorus metabolic process [inference]

regulation of nucleotide metabolic process [inference]

regulation of nucleotide biosynthetic process [inference]

positive regulation of nucleotide biosynthetic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

regulation of purine nucleotide biosynthetic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

regulation of ATP biosynthetic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of nucleotide metabolic process [inference]

positive regulation of nucleotide biosynthetic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of purine nucleotide metabolic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of ATP metabolic process [inference]

positive regulation of ATP biosynthetic process

regulation of purine nucleotide metabolic process [inference]

regulation of purine nucleotide biosynthetic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

regulation of ATP biosynthetic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of purine nucleotide metabolic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of ATP metabolic process [inference]

positive regulation of ATP biosynthetic process

regulation of ATP metabolic process [inference]

positive regulation of ATP metabolic process [inference]

positive regulation of ATP biosynthetic process

regulation of ATP biosynthetic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of phosphorus metabolic process [inference]

positive regulation of phosphate metabolic process [inference]

positive regulation of nucleotide metabolic process [inference]

positive regulation of nucleotide biosynthetic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of purine nucleotide metabolic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of ATP metabolic process [inference]

positive regulation of ATP biosynthetic process

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

regulation of DNA-templated transcription elongation [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

regulation of transcription elongation by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

regulation of DNA-templated transcription elongation [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

regulation of transcription elongation by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

regulation of DNA-templated transcription elongation [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

regulation of transcription elongation by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

regulation of small molecule metabolic process [inference]

regulation of nucleotide metabolic process [inference]

regulation of nucleotide biosynthetic process [inference]

positive regulation of nucleotide biosynthetic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

regulation of purine nucleotide biosynthetic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

regulation of ATP biosynthetic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of nucleotide metabolic process [inference]

positive regulation of nucleotide biosynthetic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of purine nucleotide metabolic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of ATP metabolic process [inference]

positive regulation of ATP biosynthetic process

regulation of purine nucleotide metabolic process [inference]

regulation of purine nucleotide biosynthetic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

regulation of ATP biosynthetic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of purine nucleotide metabolic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of ATP metabolic process [inference]

positive regulation of ATP biosynthetic process

regulation of ATP metabolic process [inference]

positive regulation of ATP metabolic process [inference]

positive regulation of ATP biosynthetic process

regulation of ATP biosynthetic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of small molecule metabolic process [inference]

positive regulation of nucleotide metabolic process [inference]

positive regulation of nucleotide biosynthetic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of purine nucleotide metabolic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of ATP metabolic process [inference]

positive regulation of ATP biosynthetic process

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

regulation of nucleotide metabolic process [inference]

regulation of nucleotide biosynthetic process [inference]

positive regulation of nucleotide biosynthetic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

regulation of purine nucleotide biosynthetic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

regulation of ATP biosynthetic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of nucleotide metabolic process [inference]

positive regulation of nucleotide biosynthetic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of purine nucleotide metabolic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of ATP metabolic process [inference]

positive regulation of ATP biosynthetic process

regulation of purine nucleotide metabolic process [inference]

regulation of purine nucleotide biosynthetic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

regulation of ATP biosynthetic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of purine nucleotide metabolic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of ATP metabolic process [inference]

positive regulation of ATP biosynthetic process

regulation of ATP metabolic process [inference]

positive regulation of ATP metabolic process [inference]

positive regulation of ATP biosynthetic process

regulation of ATP biosynthetic process [inference]

positive regulation of ATP biosynthetic process

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

regulation of DNA-templated transcription elongation [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

regulation of transcription elongation by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

regulation of cell adhesion [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of homotypic cell-cell adhesion

regulation of cell-cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of homotypic cell-cell adhesion

regulation of homotypic cell-cell adhesion [inference]

negative regulation of homotypic cell-cell adhesion

regulation of cell population proliferation [inference]

negative regulation of cell population proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of hypoxia-induced intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

regulation of cell differentiation [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis

regulation of cell development [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis

regulation of neurogenesis [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of nucleotide biosynthetic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of catabolic process [inference]

positive regulation of autophagy

positive regulation of phosphorus metabolic process [inference]

positive regulation of phosphate metabolic process [inference]

positive regulation of nucleotide metabolic process [inference]

positive regulation of nucleotide biosynthetic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of purine nucleotide metabolic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of ATP metabolic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of DNA-templated transcription, elongation [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription elongation by RNA polymerase II

positive regulation of small molecule metabolic process [inference]

positive regulation of nucleotide metabolic process [inference]

positive regulation of nucleotide biosynthetic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of purine nucleotide metabolic process [inference]

positive regulation of purine nucleotide biosynthetic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of ATP metabolic process [inference]

positive regulation of ATP biosynthetic process

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of small GTPase mediated signal transduction [inference]

positive regulation of Ras protein signal transduction

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of axonogenesis

positive regulation of cell motility [inference]

positive regulation of cell migration

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of homotypic cell-cell adhesion

negative regulation of cell population proliferation

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

negative regulation of cellular response to hypoxia [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

regulation of cellular component organization [inference]

regulation of cell projection organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of axonogenesis

regulation of plasma membrane bounded cell projection organization [inference]

regulation of neuron projection development [inference]

regulation of axonogenesis [inference]

positive regulation of axonogenesis

regulation of neuron projection regeneration [inference]

regulation of axon regeneration

regulation of organelle organization [inference]

regulation of Golgi organization [inference]

regulation of Golgi inheritance

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of axonogenesis

regulation of cellular localization [inference]

regulation of intracellular transport [inference]

regulation of early endosome to late endosome transport

regulation of protein localization to membrane [inference]

regulation of neurotransmitter receptor localization to postsynaptic specialization membrane

regulation of vesicle-mediated transport [inference]

regulation of early endosome to late endosome transport

regulation of cellular response to stress [inference]

regulation of stress-activated protein kinase signaling cascade [inference]

regulation of stress-activated MAPK cascade

regulation of neuron projection regeneration [inference]

regulation of axon regeneration

regulation of cellular response to hypoxia [inference]

negative regulation of cellular response to hypoxia [inference]

negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway

regulation of cell motility [inference]

regulation of cell migration [inference]

positive regulation of cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration

regulation of multicellular organismal process [inference]

regulation of system process [inference]

regulation of muscle system process [inference]

regulation of muscle contraction [inference]

regulation of smooth muscle contraction [inference]

regulation of vascular associated smooth muscle contraction

positive regulation of muscle contraction

regulation of blood circulation [inference]

regulation of vasoconstriction [inference]

regulation of vascular associated smooth muscle contraction

positive regulation of multicellular organismal process [inference]

positive regulation of muscle contraction

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis

regulation of multicellular organismal development [inference]

regulation of nervous system development [inference]

regulation of neurogenesis [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis

regulation of biological quality [inference]

regulation of anatomical structure size [inference]

regulation of tube size [inference]

regulation of tube diameter [inference]

blood vessel diameter maintenance [inference]

regulation of vasoconstriction [inference]

regulation of vascular associated smooth muscle contraction

regulation of neurotransmitter receptor localization to postsynaptic specialization membrane

Displaying entries **1 - 5** of 19 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
nucleus	IEA	GO_REF
mitochondrion	IEA	GO_REF
early endosome	IEA	GO_REF
late endosome	IEA	GO_REF
endoplasmic reticulum	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cytoplasm [inference]

cell cortex

neuron projection cytoplasm [inference]

dendrite cytoplasm

microtubule organizing center [inference]

cytosol

membrane [inference]

plasma membrane

cell junction [inference]

synapse [inference]

glutamatergic synapse

anchoring junction [inference]

cell-substrate junction [inference]

focal adhesion

cell projection [inference]

plasma membrane bounded cell projection [inference]

neuron projection [inference]

axon

perikaryon

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

postsynaptic specialization [inference]

postsynaptic density

perinuclear region of cytoplasm

supramolecular complex [inference]

supramolecular polymer [inference]

supramolecular fiber [inference]

polymeric cytoskeletal fiber [inference]

microtubule

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
protein serine/threonine kinase activity	IEA	GO_REF
MAP kinase kinase activity	IEA	GO_REF GO_REF GO_REF
protein tyrosine kinase activity
MAP kinase scaffold activity	IEA	GO_REF
ATP binding	IEA	GO_REF GO_REF GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

transferase activity, transferring phosphorus-containing groups [inference]

kinase activity [inference]

protein kinase activity [inference]

protein serine/threonine kinase activity

protein serine/threonine/tyrosine kinase activity [inference]

MAP kinase kinase activity

protein tyrosine kinase activity

phosphotransferase activity, alcohol group as acceptor [inference]

protein kinase activity [inference]

protein serine/threonine kinase activity

protein serine/threonine/tyrosine kinase activity [inference]

MAP kinase kinase activity

protein tyrosine kinase activity

catalytic activity, acting on a protein [inference]

protein kinase activity [inference]

protein serine/threonine kinase activity

protein serine/threonine/tyrosine kinase activity [inference]

MAP kinase kinase activity

protein tyrosine kinase activity

structural molecule activity [inference]

protein complex scaffold activity [inference]

MAP kinase scaffold activity

binding [inference]

protein binding [inference]

enzyme binding [inference]

kinase binding [inference]

protein kinase binding [inference]

mitogen-activated protein kinase kinase kinase binding

GTPase binding [inference]

small GTPase binding

scaffold protein binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

ATP binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

protein-containing complex binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

molecular adaptor activity [inference]

protein-macromolecule adaptor activity [inference]

signaling adaptor activity [inference]

MAP kinase scaffold activity

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme activator activity [inference]

kinase activator activity [inference]

protein kinase activator activity [inference]

protein serine/threonine kinase activator activity

kinase regulator activity [inference]

kinase activator activity [inference]

protein kinase activator activity [inference]

protein serine/threonine kinase activator activity

protein kinase regulator activity [inference]

protein kinase activator activity [inference]

protein serine/threonine kinase activator activity

molecular function activator activity [inference]

enzyme activator activity [inference]

kinase activator activity [inference]

protein kinase activator activity [inference]

protein serine/threonine kinase activator activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELLFGCHVEGDAAETPPRPRTPGRPLSSYGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLNQPSTPTHAASI

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
21				GlycoProtDB

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements