GlyCosmos Portal

Submissions

Far upstream element-binding protein 2

Summary

UniProt ID: Q3U0V1
Gene Symbol: Khsrp Fubp2
Gene ID: 16549
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q3U0V1
PubChem: Q3U0V1
The O-GlcNAc Database: Q3U0V1
O-GlcNAcAtlas: Q3U0V1
Re-Glyco: Q3U0V1

Annotation

Keyword: Acetylation Cytoplasm DNA-binding Isopeptide bond Methylation Nucleus Phosphoprotein RNA-binding Reference proteome Repeat Transcription regulation Ubl conjugation mRNA splicing mRNA transport

Gene Ontology (GO)

Displaying entries **1 - 5** of 20 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
regulation of transcription by RNA polymerase II
mRNA processing
mRNA catabolic process	IDA	PMID
RNA splicing
miRNA metabolic process	ISS	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

catabolic process [inference]

macromolecule catabolic process [inference]

nucleic acid catabolic process [inference]

RNA catabolic process [inference]

mRNA catabolic process

nucleobase-containing compound catabolic process [inference]

nucleic acid catabolic process [inference]

RNA catabolic process [inference]

mRNA catabolic process

macromolecule metabolic process [inference]

macromolecule catabolic process [inference]

nucleic acid catabolic process [inference]

RNA catabolic process [inference]

mRNA catabolic process

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

RNA catabolic process [inference]

mRNA catabolic process

miRNA metabolic process

mRNA metabolic process [inference]

nucleic acid catabolic process [inference]

RNA catabolic process [inference]

mRNA catabolic process

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound catabolic process [inference]

nucleic acid catabolic process [inference]

RNA catabolic process [inference]

mRNA catabolic process

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

RNA catabolic process [inference]

mRNA catabolic process

miRNA metabolic process

mRNA metabolic process [inference]

nucleic acid catabolic process [inference]

RNA catabolic process [inference]

mRNA catabolic process

RNA processing [inference]

response to stimulus [inference]

response to chemical [inference]

response to peptide [inference]

response to cytokine [inference]

cellular response to cytokine stimulus

localization [inference]

establishment of localization [inference]

transport [inference]

nitrogen compound transport [inference]

nucleobase-containing compound transport [inference]

nucleic acid transport [inference]

RNA transport [inference]

mRNA transport

establishment of RNA localization [inference]

RNA transport [inference]

mRNA transport

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of catabolic process [inference]

RNA destabilization [inference]

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

positive regulation of mRNA catabolic process

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

positive regulation of macromolecule metabolic process [inference]

positive regulation of RNA metabolic process [inference]

RNA destabilization [inference]

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

positive regulation of mRNA metabolic process [inference]

positive regulation of mRNA catabolic process

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

mRNA catabolic process

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

negative regulation of nitric oxide biosynthetic process

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

mRNA catabolic process

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

negative regulation of multicellular organismal process [inference]

negative regulation of lipoprotein particle clearance [inference]

negative regulation of low-density lipoprotein particle clearance

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

mRNA catabolic process

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

negative regulation of nitric oxide biosynthetic process

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

post-transcriptional regulation of gene expression [inference]

regulation of RNA stability [inference]

regulation of mRNA stability

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

RNA destabilization [inference]

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

negative regulation of gene expression [inference]

mRNA catabolic process

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

regulation of mRNA catabolic process [inference]

regulation of mRNA stability

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

positive regulation of mRNA catabolic process

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

mRNA catabolic process

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

regulation of nitric oxide biosynthetic process [inference]

negative regulation of nitric oxide biosynthetic process

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

mRNA catabolic process

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

negative regulation of nitric oxide biosynthetic process

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

mRNA catabolic process

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

positive regulation of metabolic process [inference]

positive regulation of catabolic process [inference]

RNA destabilization [inference]

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

positive regulation of mRNA catabolic process

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

positive regulation of macromolecule metabolic process [inference]

positive regulation of RNA metabolic process [inference]

RNA destabilization [inference]

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

positive regulation of mRNA metabolic process [inference]

positive regulation of mRNA catabolic process

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

regulation of catabolic process [inference]

positive regulation of catabolic process [inference]

RNA destabilization [inference]

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

positive regulation of mRNA catabolic process

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

regulation of RNA stability [inference]

regulation of mRNA stability

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

RNA destabilization [inference]

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

regulation of mRNA catabolic process [inference]

regulation of mRNA stability

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

positive regulation of mRNA catabolic process

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

post-transcriptional regulation of gene expression [inference]

regulation of RNA stability [inference]

regulation of mRNA stability

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

RNA destabilization [inference]

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

negative regulation of gene expression [inference]

mRNA catabolic process

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

regulation of mRNA catabolic process [inference]

regulation of mRNA stability

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

positive regulation of mRNA catabolic process

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

mRNA catabolic process

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of RNA metabolic process [inference]

RNA destabilization [inference]

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

positive regulation of mRNA metabolic process [inference]

positive regulation of mRNA catabolic process

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

mRNA catabolic process

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

regulation of RNA metabolic process [inference]

regulation of RNA stability [inference]

regulation of mRNA stability

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

RNA destabilization [inference]

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

positive regulation of RNA metabolic process [inference]

RNA destabilization [inference]

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

positive regulation of mRNA metabolic process [inference]

positive regulation of mRNA catabolic process

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

regulation of mRNA metabolic process [inference]

regulation of mRNA catabolic process [inference]

regulation of mRNA stability

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

positive regulation of mRNA catabolic process

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

positive regulation of mRNA metabolic process [inference]

positive regulation of mRNA catabolic process

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

regulation of miRNA metabolic process

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

regulation of RNA metabolic process [inference]

regulation of RNA stability [inference]

regulation of mRNA stability

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

RNA destabilization [inference]

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

positive regulation of RNA metabolic process [inference]

RNA destabilization [inference]

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

positive regulation of mRNA metabolic process [inference]

positive regulation of mRNA catabolic process

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

regulation of mRNA metabolic process [inference]

regulation of mRNA catabolic process [inference]

regulation of mRNA stability

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

positive regulation of mRNA catabolic process

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

positive regulation of mRNA metabolic process [inference]

positive regulation of mRNA catabolic process

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

regulation of miRNA metabolic process

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

regulation of nitric oxide metabolic process [inference]

regulation of nitric oxide biosynthetic process [inference]

negative regulation of nitric oxide biosynthetic process

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of catabolic process [inference]

RNA destabilization [inference]

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

positive regulation of mRNA catabolic process

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

positive regulation of macromolecule metabolic process [inference]

positive regulation of RNA metabolic process [inference]

RNA destabilization [inference]

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

positive regulation of mRNA metabolic process [inference]

positive regulation of mRNA catabolic process

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

mRNA catabolic process

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

negative regulation of nitric oxide biosynthetic process

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

mRNA catabolic process

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

regulation of multicellular organismal process [inference]

regulation of lipoprotein particle clearance [inference]

negative regulation of lipoprotein particle clearance [inference]

negative regulation of low-density lipoprotein particle clearance

regulation of low-density lipoprotein particle clearance [inference]

negative regulation of low-density lipoprotein particle clearance

negative regulation of multicellular organismal process [inference]

negative regulation of lipoprotein particle clearance [inference]

negative regulation of low-density lipoprotein particle clearance

regulation of biological quality [inference]

regulation of RNA stability [inference]

regulation of mRNA stability

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

RNA destabilization [inference]

mRNA destabilization [inference]

3'-UTR-mediated mRNA destabilization

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
nucleus	IEA	GO_REF
nucleoplasm	ISO	GO_REF
nucleoplasm	IEA	GO_REF
cytoplasm	IEA	GO_REF
cytosol	TAS	Reactome

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cell projection [inference]

plasma membrane bounded cell projection [inference]

neuron projection [inference]

dendrite

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

membraneless organelle [inference]

intracellular membraneless organelle [inference]

ribonucleoprotein granule [inference]

cytoplasmic ribonucleoprotein granule [inference]

cytoplasmic stress granule

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular membraneless organelle [inference]

ribonucleoprotein granule [inference]

cytoplasmic ribonucleoprotein granule [inference]

cytoplasmic stress granule

cell body [inference]

neuronal cell body

supramolecular complex [inference]

ribonucleoprotein granule [inference]

cytoplasmic ribonucleoprotein granule [inference]

cytoplasmic stress granule

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
DNA binding
mRNA binding	IDA	PMID
mRNA binding	IEA	GO_REF
mRNA 3'-UTR binding	ISO	GO_REF
mRNA 3'-UTR binding	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

nucleic acid binding [inference]

DNA binding

RNA binding [inference]

mRNA binding

mRNA 3'-UTR binding

mRNA 3'-UTR AU-rich region binding

protein folding chaperone

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MSDYNTGGPPPGPPPPAGGGGGAAGAGGGPPPGPPGAGDRGGGGPGGGGPGGGGASGGPSQPPGGGGPGIRKDAFADAVQRARQIAAKIGGDAATTVNNNTPDFGFGGQKRQLEDGDQPDSKKLASQGDSIGSQLGPIHPPPRTSMTEEYRVPDGMVGLIIGRGGEQINKIQQDSGCKVQISPDSGGLPERSVSLTGAPESVQKAKMMLDDIVSRGRGGPPGQFHDNANGGQNGTVQEIMIPAGKAGLVIGKGGETIKQLQERAGVKMILIQDGSQNTNVDKPLRIIGDPYKVQQACEMVMDILRERDQGGFGDRNEYGSRVGGGIDVPVPRHSVGVVIGRSGEMIKKIQNDAGVRIQFKQDDGTGPEKIAHIMGPPDRCEHAARIINDLLQSLRSGPPGPPGAPGMPPGGRGRGRGQGNWGPPGGEMTFSIPTHKCGLVIGRGGENVKAINQQTGAFVEISRQLPPNGDPNFKLFVIRGSPQQIDHAKQLIEEKIEGPLCPVGPGPGGPGPAGPMGPFNPGPFNQGPPGAPPHAGGPPPHQYPPQGWGNTYPQWQPPAPHDPNKAAAAATDPNAAWAAYYSHYYQQPPGPVPGPAPAPAAPPAQGEPPQPPPTGQSDYTKAWEEYYKKIGQQPQQPGAPPQQDYTKAWEEYYKKQAQVATGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGGPQPPPTQQGQQQASGNCHPPPPPFSFQPPATVHPALVGSAGNPFPCGVCP

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	PubMed ID	GlyTouCan ID	Source
95	21540332 22645316 24788674 25153642 28135057 28528544 34887587 35822049 36288343 36852467 40021952 40684658 40885482	G49108TO	The O-GlcNAc Database
96	21540332 22645316 24788674 25153642 28135057 28528544 34887587 35822049 36288343 36852467 40021952 40684658 40885482	G49108TO	GlyGen The O-GlcNAc Database
192	21540332 22645316 24788674 25153642 28135057 28528544 34887587 35822049 36288343 36852467 40021952 40684658 40885482	G49108TO	GlyGen The O-GlcNAc Database
704			GlyGen