GlyCosmos Portal

Submissions

Cathepsin D

Summary

UniProt ID: Q3UCD9
Gene Symbol: Ctsd
Gene ID: 13033
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0004697
Re-Glyco: Q3UCD9

Annotation

Keyword: Aspartyl protease Disulfide bond Glycoprotein Lysosome Signal Zymogen

Gene Ontology (GO)

Displaying **all 5** entries
GO Term	Evidence Code	Reference
proteolysis	IEA	GO_REF GO_REF
lipoprotein catabolic process	IEA	GO_REF
positive regulation of apoptotic process	IEA	GO_REF
regulation of establishment of protein localization	IEA	GO_REF
execution phase of apoptosis	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

catabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

lipoprotein catabolic process

macromolecule metabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

lipoprotein catabolic process

protein metabolic process [inference]

proteolysis

protein catabolic process [inference]

lipoprotein catabolic process

lipoprotein metabolic process [inference]

lipoprotein catabolic process

primary metabolic process [inference]

protein metabolic process [inference]

proteolysis

protein catabolic process [inference]

lipoprotein catabolic process

lipoprotein metabolic process [inference]

lipoprotein catabolic process

execution phase of apoptosis

biological regulation [inference]

regulation of biological process [inference]

regulation of localization [inference]

regulation of protein localization [inference]

regulation of establishment of protein localization

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

regulation of cellular process [inference]

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

positive regulation of apoptotic process

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

positive regulation of cellular process [inference]

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

Displaying **all 4** entries
GO Term	Evidence Code	Reference
lysosomal membrane	IEA	GO_REF
cytosol	IEA	GO_REF
endosome membrane	IEA	GO_REF
membrane raft	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cytosol

membrane [inference]

organelle membrane [inference]

vesicle membrane [inference]

cytoplasmic vesicle membrane [inference]

endosome membrane

bounding membrane of organelle [inference]

vacuolar membrane [inference]

lytic vacuole membrane [inference]

lysosomal membrane

endosome membrane

membrane microdomain [inference]

membrane raft

Displaying 1 entry
GO Term	Evidence Code	Reference
aspartic-type endopeptidase activity	IEA	GO_REF GO_REF GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

peptidase activity [inference]

endopeptidase activity [inference]

aspartic-type endopeptidase activity

aspartic-type peptidase activity [inference]

aspartic-type endopeptidase activity

catalytic activity, acting on a protein [inference]

peptidase activity [inference]

endopeptidase activity [inference]

aspartic-type endopeptidase activity

aspartic-type peptidase activity [inference]

aspartic-type endopeptidase activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MKTPGVLLLILGLLASSSFAIIRIPLRKFTSIRRTMTEVGGSVEDLILKGPITKYSMQSSPKTTEPVSELLKNYLDAQYYGDIGIGTPPQCFTVVFDTGSSNLWVPSIHCKILDIACWVHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSDQSKARGIKVEKQIFGEATKQPGIVFVAAKFDGILGMGYPHISVNNVLPVFDNLMQQKLVDKNIFSFYLNRDPEGQPGGELMLGGTDSKYYHGELSYLNVTRKAYWQVHMDQLEVGNELTLCKGGCEAIVDTGTSLLVGPVEEVKELQKAIGAVPLIQGEYMIPCEKVSSLPTVYLKLGGKNYELHPDKYILKVSQGGKTICLSGFMGMDIPPPSGPLWILGDVFIGSYYTVFDRDNNRVGFANAVVL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites