GlyCosmos Portal

Submissions

P2X purinoceptor

Summary

UniProt ID: Q3UN00
Gene Symbol: P2rx7 P2x7
Gene ID: 18439
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0004848
Re-Glyco: Q3UN00

Annotation

Keyword: ADP-ribosylation Cell membrane Disulfide bond Glycoprotein Ligand-gated ion channel Palmitate Phosphoprotein Proteomics identification Receptor Reference proteome Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
bleb assembly	IEA	GO_REF
positive regulation of interleukin-1 beta production	IEA	GO_REF
response to ATP	IEA	GO_REF GO_REF
pore complex assembly	IEA	GO_REF
positive regulation of cellular component organization	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

extrinsic apoptotic signaling pathway

apoptotic signaling pathway [inference]

extrinsic apoptotic signaling pathway

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cellular component assembly [inference]

cell projection assembly [inference]

plasma membrane bounded cell projection assembly [inference]

bleb assembly

protein-containing complex assembly [inference]

pore complex assembly

cell projection organization [inference]

cell projection assembly [inference]

plasma membrane bounded cell projection assembly [inference]

bleb assembly

plasma membrane bounded cell projection organization [inference]

plasma membrane bounded cell projection assembly [inference]

bleb assembly

protein-containing complex organization [inference]

protein-containing complex assembly [inference]

pore complex assembly

response to stimulus [inference]

response to chemical [inference]

response to organophosphorus [inference]

response to ATP

response to nitrogen compound [inference]

response to purine-containing compound [inference]

response to ATP

response to oxygen-containing compound [inference]

response to ATP

localization [inference]

establishment of localization [inference]

transport [inference]

organophosphate ester transport [inference]

nucleotide transport [inference]

purine nucleotide transport [inference]

adenine nucleotide transport

nitrogen compound transport [inference]

nucleobase-containing compound transport [inference]

nucleotide transport [inference]

purine nucleotide transport [inference]

adenine nucleotide transport

biological regulation [inference]

regulation of biological process [inference]

regulation of localization [inference]

regulation of transport [inference]

regulation of secretion [inference]

regulation of secretion by cell

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of cellular component organization

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

extrinsic apoptotic signaling pathway

apoptotic signaling pathway [inference]

extrinsic apoptotic signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

regulation of interleukin-1 production [inference]

regulation of interleukin-1 beta production [inference]

positive regulation of interleukin-1 beta production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

regulation of interleukin-1 production [inference]

regulation of interleukin-1 beta production [inference]

positive regulation of interleukin-1 beta production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of cellular component organization

regulation of cellular component organization [inference]

positive regulation of cellular component organization

regulation of secretion by cell

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

regulation of interleukin-1 production [inference]

regulation of interleukin-1 beta production [inference]

positive regulation of interleukin-1 beta production

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-1 production [inference]

positive regulation of interleukin-1 beta production

regulation of biological quality [inference]

regulation of membrane potential [inference]

membrane depolarization

Displaying **all 2** entries
GO Term	Evidence Code	Reference
plasma membrane	IEA	GO_REF GO_REF GO_REF
postsynapse	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

postsynapse

Displaying **all 3** entries
GO Term	Evidence Code	Reference
purinergic nucleotide receptor activity	IEA	GO_REF
extracellularly ATP-gated monoatomic cation channel activity	IEA	GO_REF GO_REF
ATP binding	IEA	GO_REF GO_REF

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity [inference]

monoatomic ion transmembrane transporter activity [inference]

monoatomic ion channel activity [inference]

monoatomic cation channel activity [inference]

ligand-gated monoatomic cation channel activity [inference]

extracellularly ATP-gated monoatomic cation channel activity

ligand-gated monoatomic ion channel activity [inference]

extracellular ligand-gated monoatomic ion channel activity [inference]

excitatory extracellular ligand-gated monoatomic ion channel activity [inference]

extracellularly ATP-gated monoatomic cation channel activity

ligand-gated monoatomic cation channel activity [inference]

extracellularly ATP-gated monoatomic cation channel activity

monoatomic cation transmembrane transporter activity [inference]

monoatomic cation channel activity [inference]

ligand-gated monoatomic cation channel activity [inference]

extracellularly ATP-gated monoatomic cation channel activity

passive transmembrane transporter activity [inference]

channel activity [inference]

monoatomic ion channel activity [inference]

monoatomic cation channel activity [inference]

ligand-gated monoatomic cation channel activity [inference]

extracellularly ATP-gated monoatomic cation channel activity

ligand-gated monoatomic ion channel activity [inference]

extracellular ligand-gated monoatomic ion channel activity [inference]

excitatory extracellular ligand-gated monoatomic ion channel activity [inference]

extracellularly ATP-gated monoatomic cation channel activity

ligand-gated monoatomic cation channel activity [inference]

extracellularly ATP-gated monoatomic cation channel activity

gated channel activity [inference]

ligand-gated channel activity [inference]

ligand-gated monoatomic ion channel activity [inference]

extracellular ligand-gated monoatomic ion channel activity [inference]

excitatory extracellular ligand-gated monoatomic ion channel activity [inference]

extracellularly ATP-gated monoatomic cation channel activity

ligand-gated monoatomic cation channel activity [inference]

extracellularly ATP-gated monoatomic cation channel activity

ATP-gated ion channel activity [inference]

extracellularly ATP-gated monoatomic cation channel activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

ATP binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

molecular transducer activity [inference]

signaling receptor activity [inference]

transmembrane signaling receptor activity [inference]

nucleotide receptor activity [inference]

purinergic nucleotide receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MPACCSWNDVLQYETNKVTRIQSTNYGTVKWVLHMIVFSYISFALVSDKLYQRKEPVISSVHTKVKGIAEVTENVTEGGVTKLGHSIFDTADYTFPLQGNSFFVMTNYVKSEGQVQTLCPEYPRRGAQCSSDRRCKKGWMDPQSKGIQTGRCVPYDKTRKTCEVSAWCPTEEEKEAPRPALLRSAENFTVLIKNNIHFPGHNYTTRNILPTMNGSCTFHKTWDPQCSIFRLGDIFQEAGENFTEVAVQGGIMGIEIYWDCNLDSWSHHCRPRYSFRRLDDKNTDESFVPGYNFRYAKYYKENNVEKRTLIKAFGIRFDILVFGTGGKFDIIQLVVYIGSTLSYFGLATVCIDLLINTYSSAFCRSGVYPYCKCCEPCTVNEYYYRKKCESIMEPKPTLKYVSFVDEPHIRMVDQQLLGKSLQVVKGQEVPT

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites