GlyCosmos Portal

Submissions

Frizzled-8

Summary

UniProt ID: Q498S8
Gene Symbol: Fzd8
Gene ID: 364754
Organism: Rattus norvegicus (Norway rat)

External Links

Re-Glyco: Q498S8

Annotation

Keyword: Cell membrane Developmental protein Disulfide bond G-protein coupled receptor Glycoprotein Golgi apparatus Reference proteome Signal Transmembrane helix Ubl conjugation Wnt signaling pathway

Gene Ontology (GO)

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
angiogenesis	ISO	GO_REF
Wnt signaling pathway	ISO	GO_REF
T cell differentiation in thymus	ISO	GO_REF
non-canonical Wnt signaling pathway	IBA	GO_REF
canonical Wnt signaling pathway	ISO	GO_REF

GO Hierarchy

biological process

immune system process [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

lymphocyte differentiation [inference]

T cell differentiation [inference]

T cell differentiation in thymus

T cell activation [inference]

T cell differentiation [inference]

T cell differentiation in thymus

cellular process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

lymphocyte differentiation [inference]

T cell differentiation [inference]

T cell differentiation in thymus

T cell activation [inference]

T cell differentiation [inference]

T cell differentiation in thymus

signal transduction [inference]

cell surface receptor signaling pathway [inference]

Wnt signaling pathway

cellular developmental process [inference]

cell differentiation [inference]

leukocyte differentiation [inference]

mononuclear cell differentiation [inference]

lymphocyte differentiation [inference]

T cell differentiation [inference]

T cell differentiation in thymus

multicellular organismal process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

lymphocyte differentiation [inference]

T cell differentiation [inference]

T cell differentiation in thymus

T cell activation [inference]

T cell differentiation [inference]

T cell differentiation in thymus

developmental process [inference]

anatomical structure formation involved in morphogenesis [inference]

angiogenesis

cellular developmental process [inference]

cell differentiation [inference]

leukocyte differentiation [inference]

mononuclear cell differentiation [inference]

lymphocyte differentiation [inference]

T cell differentiation [inference]

T cell differentiation in thymus

biological regulation [inference]

regulation of biological process [inference]

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

Wnt signaling pathway

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
Golgi apparatus	IEA	GO_REF
plasma membrane	ISO	GO_REF
plasma membrane	IBA	GO_REF
plasma membrane	IEA	GO_REF GO_REF
neuronal dense core vesicle	ISO	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

membrane protein complex [inference]

plasma membrane protein complex [inference]

Wnt-Frizzled-LRP5/6 complex

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

secretory vesicle [inference]

secretory granule [inference]

dense core granule [inference]

neuronal dense core vesicle

intracellular membrane-bounded organelle [inference]

Golgi apparatus

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

secretory vesicle [inference]

secretory granule [inference]

dense core granule [inference]

neuronal dense core vesicle

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

Golgi apparatus

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

secretory vesicle [inference]

secretory granule [inference]

dense core granule [inference]

neuronal dense core vesicle

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
G protein-coupled receptor activity
signaling receptor binding	ISO	GO_REF
signaling receptor binding	IEA	GO_REF
Wnt-protein binding	ISO	GO_REF
Wnt-protein binding	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

enzyme binding [inference]

ubiquitin-like protein ligase binding [inference]

ubiquitin protein ligase binding

protein domain specific binding [inference]

PDZ domain binding

molecular transducer activity [inference]

signaling receptor activity [inference]

transmembrane signaling receptor activity [inference]

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MEWGYLLEVTSLLAALAVLQRSSGAAAASAKELACQEITVPLCKGIGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPSPPRRLPPPQPGEQPPSGSGHSRPPGARPPHRGGSSRGSGDTAAAPPSRGGKARPPGGGAAPCEPGCQCRAPMVSVSSERHPLYNRVKTGQIANCALPCHNPFFSQDERAFTVFWIGLWSVLCFVSTFATVSTFLIDMERFKYPERPIIFLSACYLFVSVGYLVRLVAGHEKVACSGGAPGAGGAGGAGGAATAGAGAAGAGASSPGARGEYEELGAVEQHVRYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLDNLRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQQGGPTKTHKLEKLMIRLGLFTVLYTVPAAVVVACLFYEQHNRPRWEATHNCPCLRDLQPDQARRPDYAVFMLKYFMCLVVGITSGVWVWSGKTLESWRALCTRCCWASKGAAVGAGAGGSGPGGGGPGPGGGGGHGGGGGSLYSDVSTGLTWRSGTASSVSYPKQMPLSQV

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	Description	Source
49	N-linked (GlcNAc...) asparagine	UniProt
152	N-linked (GlcNAc...) asparagine	UniProt
472	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Asymmetric localization of PCP proteins	Rattus norvegicus
Regulation of FZD by ubiquitination	Rattus norvegicus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements