GlyCosmos Portal

Submissions

Histocompatibility 2, Q region locus 2

Summary

UniProt ID: Q4KN81
Gene Symbol: H2-Q2 Gm11132
Gene ID: 15013
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0005126
Re-Glyco: Q4KN81

Annotation

Keyword: Glycoprotein MHC I Proteomics identification Reference proteome Signal Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
positive regulation of T cell mediated cytotoxicity	IBA	GO_REF
antigen processing and presentation of endogenous peptide antigen via MHC class Ib	IBA	GO_REF
antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-independent	IBA	GO_REF
immune response	IBA	GO_REF
immune response	IEA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune response

antigen processing and presentation [inference]

antigen processing and presentation via MHC class Ib [inference]

antigen processing and presentation of peptide antigen via MHC class Ib [inference]

antigen processing and presentation of endogenous peptide antigen via MHC class Ib

antigen processing and presentation of endogenous antigen [inference]

antigen processing and presentation of endogenous peptide antigen [inference]

antigen processing and presentation of endogenous peptide antigen via MHC class Ib

antigen processing and presentation of endogenous peptide antigen via MHC class I [inference]

antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway [inference]

antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-independent

antigen processing and presentation of peptide antigen [inference]

antigen processing and presentation of peptide antigen via MHC class Ib [inference]

antigen processing and presentation of endogenous peptide antigen via MHC class Ib

antigen processing and presentation of peptide antigen via MHC class I [inference]

antigen processing and presentation of endogenous peptide antigen via MHC class I [inference]

antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway [inference]

antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-independent

antigen processing and presentation of endogenous peptide antigen [inference]

antigen processing and presentation of endogenous peptide antigen via MHC class Ib

antigen processing and presentation of endogenous peptide antigen via MHC class I [inference]

antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway [inference]

antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-independent

reproductive process [inference]

multi-organism reproductive process [inference]

female pregnancy

multicellular organismal process [inference]

multicellular organism growth

multi-multicellular organism process [inference]

female pregnancy

growth [inference]

developmental growth [inference]

multicellular organism growth

response to stimulus [inference]

immune response

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of immune effector process [inference]

positive regulation of leukocyte mediated immunity [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of lymphocyte mediated immunity [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of immune effector process [inference]

positive regulation of immune effector process [inference]

positive regulation of leukocyte mediated immunity [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of lymphocyte mediated immunity [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of leukocyte mediated immunity [inference]

regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of T cell mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of leukocyte mediated immunity [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of lymphocyte mediated immunity [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of lymphocyte mediated immunity [inference]

positive regulation of lymphocyte mediated immunity [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of T cell mediated immunity [inference]

regulation of T cell mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of immune response [inference]

regulation of adaptive immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

regulation of T cell mediated immunity [inference]

regulation of T cell mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of immune effector process [inference]

positive regulation of leukocyte mediated immunity [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of lymphocyte mediated immunity [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of cellular process [inference]

positive regulation of cell killing [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of response to stimulus [inference]

positive regulation of immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of response to stimulus [inference]

positive regulation of response to stimulus [inference]

positive regulation of immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of immune response [inference]

regulation of adaptive immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

regulation of T cell mediated immunity [inference]

regulation of T cell mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of cellular process [inference]

regulation of cell killing [inference]

regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

regulation of T cell mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of cell killing [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

positive regulation of cellular process [inference]

positive regulation of cell killing [inference]

positive regulation of leukocyte mediated cytotoxicity [inference]

positive regulation of T cell mediated cytotoxicity

Displaying entries **1 - 5** of 18 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
Golgi membrane	ISO	GO_REF
obsolete extracellular space
lysosomal membrane	ISO	GO_REF
early endosome	ISO	GO_REF
endoplasmic reticulum	ISO	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

membrane protein complex [inference]

MHC class I peptide loading complex

plasma membrane protein complex [inference]

MHC protein complex [inference]

endoplasmic reticulum protein-containing complex [inference]

MHC class I peptide loading complex

cellular anatomical structure [inference]

cell surface

membrane [inference]

plasma membrane

organelle membrane [inference]

vesicle membrane [inference]

cytoplasmic vesicle membrane [inference]

endosome membrane [inference]

early endosome membrane

endocytic vesicle membrane [inference]

phagocytic vesicle membrane

bounding membrane of organelle [inference]

Golgi membrane

vacuolar membrane [inference]

lytic vacuole membrane [inference]

lysosomal membrane

endosome membrane [inference]

early endosome membrane

endocytic vesicle membrane [inference]

phagocytic vesicle membrane

cis-Golgi network membrane

organelle subcompartment [inference]

Golgi apparatus subcompartment [inference]

Golgi cisterna [inference]

Golgi medial cisterna

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

early endosome

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

early endosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

early endosome

endoplasmic reticulum exit site

side of membrane [inference]

external side of plasma membrane

lumenal side of membrane [inference]

lumenal side of endoplasmic reticulum membrane

Displaying entries **1 - 5** of 21 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
signaling receptor binding	ISO	GO_REF
signaling receptor binding	IBA	GO_REF
beta-2-microglobulin binding	ISO	GO_REF GO_REF
beta-2-microglobulin binding	IBA	GO_REF
peptide binding	ISO	GO_REF

GO Hierarchy

molecular function

binding [inference]

antigen binding [inference]

peptide antigen binding

protein binding [inference]

signaling receptor binding

MHC protein binding [inference]

MHC class I protein binding

beta-2-microglobulin binding

identical protein binding

protein homodimerization activity

TAP binding

protein dimerization activity [inference]

protein homodimerization activity

peptide binding

peptide antigen binding

protein-containing complex binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MALRRLLLLLVAALKLTETRAGSHSLRYFTTAVSRPGLGEPRFIIVGYVDDTQFVRFDSDAENPRMEPRAPWMEQEGPEYWERNTQVSKENEQSFRVSLGTALSYYNQSKGGSHTLQWLVGCDLGPDGSLLRGYEQSAYDGRDYLALNEDLITWTAADLAALKTRSKLEQAGLAEKRRAYLEVDCLTWLRRYLELGKETLLHTDPPKAHVTHHPSSQGDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVETRPSGDGTFQKWASVMVPFGEEPRYTCHVEHEGLPEPLTLRWEPPPSTDSYMVIIAVLVVLGAVIIIGAVVAFVMKRGRNTGGKVRDYAQDPGRDSPQSSDISLLEL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
107				GlycoProtDB

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements