GlyCosmos Portal

Submissions

Hematopoietic progenitor cell antigen CD34

Summary

UniProt ID: Q543B6
Gene Symbol: Cd34
Gene ID: 12490
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0005190
Re-Glyco: Q543B6

Annotation

Keyword: Cell adhesion Glycoprotein Signal Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 18 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
tissue homeostasis	IEA	GO_REF
endothelial cell proliferation	IEA	GO_REF
glomerular filtration	IEA	GO_REF
signal transduction	IEA	GO_REF
negative regulation of interleukin-2 production	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cell communication [inference]

cell-cell signaling [inference]

paracrine signaling

cell adhesion [inference]

cell-cell adhesion

signal transduction

cell population proliferation [inference]

epithelial cell proliferation [inference]

endothelial cell proliferation

stem cell proliferation [inference]

hematopoietic stem cell proliferation

cellular developmental process [inference]

cell differentiation [inference]

epithelial cell differentiation [inference]

epithelial cell differentiation involved in kidney development [inference]

glomerular mesangial cell differentiation [inference]

metanephric glomerular mesangial cell differentiation

transdifferentiation

cell differentiation involved in kidney development [inference]

epithelial cell differentiation involved in kidney development [inference]

glomerular mesangial cell differentiation [inference]

metanephric glomerular mesangial cell differentiation

mesangial cell differentiation [inference]

glomerular mesangial cell differentiation [inference]

metanephric glomerular mesangial cell differentiation

metanephric mesangial cell differentiation [inference]

metanephric glomerular mesangial cell differentiation

pericyte cell differentiation [inference]

mesangial cell differentiation [inference]

glomerular mesangial cell differentiation [inference]

metanephric glomerular mesangial cell differentiation

metanephric mesangial cell differentiation [inference]

metanephric glomerular mesangial cell differentiation

cell motility

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

vesicle organization [inference]

extracellular exosome assembly

organelle assembly [inference]

extracellular exosome assembly

cellular component assembly [inference]

organelle assembly [inference]

extracellular exosome assembly

multicellular organismal process [inference]

system process [inference]

renal system process [inference]

renal filtration [inference]

glomerular filtration

multicellular organismal-level homeostasis [inference]

anatomical structure homeostasis [inference]

tissue homeostasis

developmental process [inference]

anatomical structure formation involved in morphogenesis [inference]

angiogenesis [inference]

angiogenesis involved in wound healing [inference]

vascular wound healing

anatomical structure development [inference]

tissue development [inference]

epithelium development [inference]

endothelium development [inference]

glomerular endothelium development

kidney epithelium development [inference]

nephron epithelium development [inference]

glomerular epithelium development [inference]

glomerular endothelium development

cellular developmental process [inference]

cell differentiation [inference]

epithelial cell differentiation [inference]

epithelial cell differentiation involved in kidney development [inference]

glomerular mesangial cell differentiation [inference]

metanephric glomerular mesangial cell differentiation

transdifferentiation

cell differentiation involved in kidney development [inference]

epithelial cell differentiation involved in kidney development [inference]

glomerular mesangial cell differentiation [inference]

metanephric glomerular mesangial cell differentiation

mesangial cell differentiation [inference]

glomerular mesangial cell differentiation [inference]

metanephric glomerular mesangial cell differentiation

metanephric mesangial cell differentiation [inference]

metanephric glomerular mesangial cell differentiation

pericyte cell differentiation [inference]

mesangial cell differentiation [inference]

glomerular mesangial cell differentiation [inference]

metanephric glomerular mesangial cell differentiation

metanephric mesangial cell differentiation [inference]

metanephric glomerular mesangial cell differentiation

homeostatic process [inference]

multicellular organismal-level homeostasis [inference]

anatomical structure homeostasis [inference]

tissue homeostasis

biological regulation [inference]

regulation of biological process [inference]

signaling [inference]

cell-cell signaling [inference]

paracrine signaling

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of macrophage colony-stimulating factor production [inference]

positive regulation of granulocyte colony-stimulating factor production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of macrophage colony-stimulating factor production [inference]

positive regulation of granulocyte colony-stimulating factor production

positive regulation of cell differentiation [inference]

positive regulation of vasculogenesis

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of vasculogenesis

positive regulation of animal organ morphogenesis [inference]

positive regulation of odontogenesis

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of macrophage colony-stimulating factor production [inference]

positive regulation of granulocyte colony-stimulating factor production

positive regulation of animal organ morphogenesis [inference]

positive regulation of odontogenesis

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

negative regulation of multicellular organismal process [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of angiogenesis [inference]

positive regulation of angiogenesis

regulation of animal organ morphogenesis [inference]

regulation of odontogenesis [inference]

positive regulation of odontogenesis

positive regulation of animal organ morphogenesis [inference]

positive regulation of odontogenesis

regulation of cell differentiation [inference]

positive regulation of cell differentiation [inference]

positive regulation of vasculogenesis

regulation of vasculogenesis [inference]

positive regulation of vasculogenesis

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of vasculogenesis

positive regulation of animal organ morphogenesis [inference]

positive regulation of odontogenesis

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

positive regulation of angiogenesis

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

regulation of cellular process [inference]

signal transduction

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of macrophage colony-stimulating factor production [inference]

positive regulation of granulocyte colony-stimulating factor production

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

positive regulation of cytokine production [inference]

positive regulation of macrophage colony-stimulating factor production [inference]

positive regulation of granulocyte colony-stimulating factor production

regulation of interleukin-2 production [inference]

negative regulation of interleukin-2 production

regulation of macrophage colony-stimulating factor production [inference]

regulation of granulocyte colony-stimulating factor production [inference]

positive regulation of granulocyte colony-stimulating factor production

positive regulation of macrophage colony-stimulating factor production [inference]

positive regulation of granulocyte colony-stimulating factor production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of macrophage colony-stimulating factor production [inference]

positive regulation of granulocyte colony-stimulating factor production

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of macrophage colony-stimulating factor production [inference]

positive regulation of granulocyte colony-stimulating factor production

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of macrophage colony-stimulating factor production [inference]

positive regulation of granulocyte colony-stimulating factor production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of macrophage colony-stimulating factor production [inference]

positive regulation of granulocyte colony-stimulating factor production

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

positive regulation of cytokine production [inference]

positive regulation of macrophage colony-stimulating factor production [inference]

positive regulation of granulocyte colony-stimulating factor production

regulation of interleukin-2 production [inference]

negative regulation of interleukin-2 production

regulation of macrophage colony-stimulating factor production [inference]

regulation of granulocyte colony-stimulating factor production [inference]

positive regulation of granulocyte colony-stimulating factor production

positive regulation of macrophage colony-stimulating factor production [inference]

positive regulation of granulocyte colony-stimulating factor production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of macrophage colony-stimulating factor production [inference]

positive regulation of granulocyte colony-stimulating factor production

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of macrophage colony-stimulating factor production [inference]

positive regulation of granulocyte colony-stimulating factor production

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of macrophage colony-stimulating factor production [inference]

positive regulation of granulocyte colony-stimulating factor production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

regulation of cell differentiation [inference]

positive regulation of cell differentiation [inference]

positive regulation of vasculogenesis

regulation of vasculogenesis [inference]

positive regulation of vasculogenesis

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of macrophage colony-stimulating factor production [inference]

positive regulation of granulocyte colony-stimulating factor production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of macrophage colony-stimulating factor production [inference]

positive regulation of granulocyte colony-stimulating factor production

positive regulation of cell differentiation [inference]

positive regulation of vasculogenesis

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

positive regulation of cytokine production [inference]

positive regulation of macrophage colony-stimulating factor production [inference]

positive regulation of granulocyte colony-stimulating factor production

regulation of interleukin-2 production [inference]

negative regulation of interleukin-2 production

regulation of macrophage colony-stimulating factor production [inference]

regulation of granulocyte colony-stimulating factor production [inference]

positive regulation of granulocyte colony-stimulating factor production

positive regulation of macrophage colony-stimulating factor production [inference]

positive regulation of granulocyte colony-stimulating factor production

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of macrophage colony-stimulating factor production [inference]

positive regulation of granulocyte colony-stimulating factor production

positive regulation of animal organ morphogenesis [inference]

positive regulation of odontogenesis

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

negative regulation of multicellular organismal process [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

positive regulation of angiogenesis

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

Displaying **all 3** entries
GO Term	Evidence Code	Reference
external side of plasma membrane	IEA	GO_REF
intercellular bridge	IEA	GO_REF
perinuclear region of cytoplasm	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

side of membrane [inference]

external side of plasma membrane

Displaying **all 2** entries
GO Term	Evidence Code	Reference
carbohydrate binding	IEA	GO_REF
RNA polymerase II-specific DNA-binding transcription factor binding	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

transcription factor binding [inference]

DNA-binding transcription factor binding [inference]

RNA polymerase II-specific DNA-binding transcription factor binding

carbohydrate binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MQVHRDTRAGLLLPWRWVALCLMSLLHLNNLTSATTETSTQGISPSVPTNESVEENITSSIPGSTSHYLIYQDSSKTTPAISETMVNFTVTSGIPSGSGTPHTFSQPQTSPTGILPTTSDSISTSEMTWKSSLPSINVSDYSPNNSSFEMTSPTEPYAYTSSSAPSAIKGEIKCSGIREVRLAQGICLELSEASSCEEFKKEKGEDLIQILCEKEEAEADAGASVCSLLLAQSEVRPECLLMVLANSTELPSKLQLMEKHQSDLRKLGIQSFNKQDIGSHQSYSRKTLIALVTSGVLLAILGTTGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGASPETQGKANVTRGAQENGTGQATSRNGHSARQHVVADTEL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
246				GlycoProtDB

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements