GlyCosmos Portal

Submissions

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2

Summary

UniProt ID: Q59J78
Gene Symbol: Ndufa12l Ndufaf2
Gene ID: 75597
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q59J78
PubChem: Q59J78
O-GlcNAcAtlas: Q59J78
Re-Glyco: Q59J78

Annotation

Keyword: 3D-structure Chaperone Cilium biogenesis/degradation Mitochondrion Phosphoprotein Reference proteome Transit peptide

Gene Ontology (GO)

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
mitochondrial respiratory chain complex I assembly	ISO	GO_REF
mitochondrial respiratory chain complex I assembly	IMP	PMID
mitochondrial respiratory chain complex I assembly	IBA	GO_REF
mitochondrial respiratory chain complex I assembly	IEA	GO_REF
cilium assembly	ISS	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

cilium organization [inference]

cilium assembly

organelle assembly [inference]

cilium assembly

cellular component assembly [inference]

cell projection assembly [inference]

plasma membrane bounded cell projection assembly [inference]

cilium assembly

protein-containing complex assembly [inference]

NADH dehydrogenase complex assembly [inference]

mitochondrial respiratory chain complex I assembly

mitochondrial respiratory chain complex assembly [inference]

mitochondrial respiratory chain complex I assembly

organelle assembly [inference]

cilium assembly

cell projection organization [inference]

cell projection assembly [inference]

plasma membrane bounded cell projection assembly [inference]

cilium assembly

plasma membrane bounded cell projection organization [inference]

cilium organization [inference]

cilium assembly

plasma membrane bounded cell projection assembly [inference]

cilium assembly

protein-containing complex organization [inference]

protein-containing complex assembly [inference]

NADH dehydrogenase complex assembly [inference]

mitochondrial respiratory chain complex I assembly

mitochondrial respiratory chain complex assembly [inference]

mitochondrial respiratory chain complex I assembly

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

negative regulation of signaling [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of hormone secretion [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of peptide hormone secretion [inference]

regulation of insulin secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of insulin secretion involved in cellular response to glucose stimulus [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of localization [inference]

regulation of protein localization [inference]

regulation of establishment of protein localization [inference]

regulation of protein transport [inference]

regulation of protein secretion [inference]

negative regulation of protein secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of insulin secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of insulin secretion involved in cellular response to glucose stimulus [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of protein transport [inference]

negative regulation of protein secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of establishment of protein localization [inference]

negative regulation of protein transport [inference]

negative regulation of protein secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of protein localization [inference]

negative regulation of protein transport [inference]

negative regulation of protein secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of transport [inference]

regulation of secretion [inference]

regulation of peptide secretion [inference]

negative regulation of peptide secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of peptide hormone secretion [inference]

regulation of insulin secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of insulin secretion involved in cellular response to glucose stimulus [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of secretion [inference]

negative regulation of peptide secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of secretion by cell [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of protein secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of secretion by cell [inference]

regulation of hormone secretion [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of peptide hormone secretion [inference]

regulation of insulin secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of insulin secretion involved in cellular response to glucose stimulus [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of protein secretion [inference]

negative regulation of protein secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of insulin secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of insulin secretion involved in cellular response to glucose stimulus [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of secretion by cell [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of protein secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of transport [inference]

negative regulation of secretion [inference]

negative regulation of peptide secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of secretion by cell [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of protein secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of protein transport [inference]

negative regulation of protein secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of protein transport [inference]

regulation of protein secretion [inference]

negative regulation of protein secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of insulin secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of insulin secretion involved in cellular response to glucose stimulus [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of protein transport [inference]

negative regulation of protein secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of peptide transport [inference]

regulation of peptide secretion [inference]

negative regulation of peptide secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of peptide hormone secretion [inference]

regulation of insulin secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of insulin secretion involved in cellular response to glucose stimulus [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of cellular localization [inference]

regulation of insulin secretion involved in cellular response to glucose stimulus [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of secretion by cell [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of protein secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of response to stimulus [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of transport [inference]

negative regulation of secretion [inference]

negative regulation of peptide secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of secretion by cell [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of protein secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of protein transport [inference]

negative regulation of protein secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of protein localization [inference]

negative regulation of protein transport [inference]

negative regulation of protein secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of establishment of protein localization [inference]

negative regulation of protein transport [inference]

negative regulation of protein secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of response to stimulus [inference]

negative regulation of response to stimulus [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of cellular process [inference]

regulation of cell communication [inference]

negative regulation of cell communication [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of hormone secretion [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of peptide hormone secretion [inference]

regulation of insulin secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of insulin secretion involved in cellular response to glucose stimulus [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of secretion by cell [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of protein secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of cellular localization [inference]

regulation of insulin secretion involved in cellular response to glucose stimulus [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of secretion by cell [inference]

regulation of hormone secretion [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of peptide hormone secretion [inference]

regulation of insulin secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of insulin secretion involved in cellular response to glucose stimulus [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of protein secretion [inference]

negative regulation of protein secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of insulin secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of insulin secretion involved in cellular response to glucose stimulus [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of secretion by cell [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of protein secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of biological quality [inference]

regulation of hormone levels [inference]

regulation of hormone secretion [inference]

negative regulation of hormone secretion [inference]

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of peptide hormone secretion [inference]

regulation of insulin secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

regulation of insulin secretion involved in cellular response to glucose stimulus [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

negative regulation of peptide hormone secretion [inference]

negative regulation of insulin secretion [inference]

negative regulation of insulin secretion involved in cellular response to glucose stimulus

Displaying **all 5** entries
GO Term	Evidence Code	Reference
mitochondrion	ISS	GO_REF
mitochondrion	ISO	GO_REF GO_REF
mitochondrion	IBA	GO_REF
mitochondrion	IEA	GO_REF GO_REF
respiratory chain complex I	IEA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

membrane protein complex [inference]

NADH dehydrogenase complex [inference]

respiratory chain complex I

transmembrane transporter complex [inference]

respiratory chain complex I

respiratory chain complex [inference]

respiratory chain complex I

catalytic complex [inference]

oxidoreductase complex [inference]

NADH dehydrogenase complex [inference]

respiratory chain complex I

transporter complex [inference]

transmembrane transporter complex [inference]

respiratory chain complex I

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

Displaying **all 2** entries
GO Term	Evidence Code	Reference
protein-containing complex binding	ISO	GO_REF
protein-containing complex binding	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein-containing complex binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MSWWSGVWRSVWSALSREVREHVGTDHLGNKYYYVAEYKNWRGQTIREKRIVEAANRKEVDYEAGDIPTEWEAWIRRTRKTPPTMEEILKNEKYREEIKIKSQDFYEKDKLGKETSEELLPSPTATQVKGHASAPYFGREEPSVAPTSTGKTFQPGSWTPEDGKRQSQ

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
147				GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Complex I biogenesis	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements