GlyCosmos Portal

Submissions

Interferon gamma

Summary

UniProt ID: Q5CCK0
Gene Symbol: IFNG
Gene ID
Organism: Phodopus sungorus (winter white dwarf hamster)

External Links

Re-Glyco: Q5CCK0

Annotation

Keyword: Antiviral defense Cytokine Glycoprotein Growth regulation Pyrrolidone carboxylic acid Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
microglial cell activation	IEA	GO_REF
adaptive immune response	IEA	GO_REF
humoral immune response	IEA	GO_REF
regulation of nervous system process	IEA	GO_REF
positive regulation of MHC class II biosynthetic process	IEA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune response [inference]

leukocyte activation [inference]

leukocyte activation involved in inflammatory response [inference]

microglial cell activation

myeloid leukocyte activation [inference]

macrophage activation [inference]

microglial cell activation

cellular process [inference]

cell activation [inference]

leukocyte activation [inference]

leukocyte activation involved in inflammatory response [inference]

microglial cell activation

myeloid leukocyte activation [inference]

macrophage activation [inference]

microglial cell activation

glial cell activation [inference]

microglial cell activation

signal transduction [inference]

cell surface receptor signaling pathway [inference]

cytokine-mediated signaling pathway [inference]

interferon-mediated signaling pathway [inference]

type II interferon-mediated signaling pathway

multicellular organismal process [inference]

cell activation [inference]

leukocyte activation [inference]

leukocyte activation involved in inflammatory response [inference]

microglial cell activation

myeloid leukocyte activation [inference]

macrophage activation [inference]

microglial cell activation

glial cell activation [inference]

microglial cell activation

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

response to virus [inference]

defense response to virus

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to virus

immune response [inference]

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to virus [inference]

defense response to virus

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to virus [inference]

defense response to virus

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of MHC class II biosynthetic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of MHC class II biosynthetic process

positive regulation of cell adhesion

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

cytokine-mediated signaling pathway [inference]

interferon-mediated signaling pathway [inference]

type II interferon-mediated signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of MHC class II biosynthetic process

regulation of macromolecule biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of MHC class II biosynthetic process

regulation of MHC class II biosynthetic process [inference]

positive regulation of MHC class II biosynthetic process

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of MHC class II biosynthetic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of MHC class II biosynthetic process

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of MHC class II biosynthetic process

regulation of MHC class II biosynthetic process [inference]

positive regulation of MHC class II biosynthetic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of MHC class II biosynthetic process

regulation of cell adhesion [inference]

positive regulation of cell adhesion

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of MHC class II biosynthetic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of MHC class II biosynthetic process

positive regulation of cell adhesion

regulation of multicellular organismal process [inference]

regulation of system process [inference]

regulation of nervous system process

Displaying 1 entry
GO Term	Evidence Code	Reference
obsolete extracellular space

GO Hierarchy

cellular component

Displaying **all 2** entries
GO Term	Evidence Code	Reference
cytokine activity	IEA	GO_REF GO_REF
type II interferon receptor binding	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

cytokine receptor binding [inference]

type II interferon receptor binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

cytokine activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

cytokine activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MNSTRCILALLLCLTQAMSGCYGQGSLIEEIENLKEYFNSSSLDVGKGGDLLFNILMSWQKDGDTKIIESQIVSFYFKLFEALKGNQAIQRSIDTIKADLFVKFFNSSMEKLNDFVKLTKIPVNDPQVQRKAVNELLSVMPHLSPKLSLRKRKRSRCCFGGGNRPVKNNLASTI

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites