GlyCosmos Portal

Submissions

Ficolin-2

Summary

UniProt ID: Q5I2E5
Gene Symbol: FCN2
Gene ID: 497016
Organism: Bos taurus (domestic cattle)

External Links

Re-Glyco: Q5I2E5

Annotation

Keyword: Calcium Collagen Complement activation lectin pathway Disulfide bond Glycoprotein Lectin Metal-binding Reference proteome Repeat Secreted Signal

Gene Ontology (GO)

Displaying **all 2** entries
GO Term	Evidence Code	Reference
complement activation, lectin pathway	ISS	GO_REF
complement activation, lectin pathway	IBA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune effector process [inference]

complement activation [inference]

complement activation, lectin pathway

activation of immune response [inference]

complement activation [inference]

complement activation, lectin pathway

immune response [inference]

humoral immune response [inference]

complement activation [inference]

complement activation, lectin pathway

innate immune response [inference]

complement activation, lectin pathway

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

complement activation, lectin pathway

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

complement activation, lectin pathway

immune response [inference]

humoral immune response [inference]

complement activation [inference]

complement activation, lectin pathway

innate immune response [inference]

complement activation, lectin pathway

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

complement activation, lectin pathway

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

complement activation, lectin pathway

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

complement activation [inference]

complement activation, lectin pathway

regulation of immune response [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

complement activation [inference]

complement activation, lectin pathway

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

complement activation [inference]

complement activation, lectin pathway

positive regulation of response to stimulus [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

complement activation [inference]

complement activation, lectin pathway

regulation of response to stimulus [inference]

positive regulation of response to stimulus [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

complement activation [inference]

complement activation, lectin pathway

regulation of immune response [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

complement activation [inference]

complement activation, lectin pathway

Displaying **all 3** entries
GO Term	Evidence Code	Reference
collagen trimer
obsolete extracellular space
symbiont cell surface	ISS	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

collagen trimer

cellular anatomical structure [inference]

other organism part [inference]

symbiont cell surface

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
antigen binding	IBA	GO_REF
signaling receptor binding	IBA	GO_REF
carbohydrate binding
pattern recognition receptor activity	ISS	GO_REF
metal ion binding

GO Hierarchy

molecular function

binding [inference]

antigen binding

protein binding [inference]

signaling receptor binding

carbohydrate binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding

carbohydrate derivative binding

molecular transducer activity [inference]

signaling receptor activity [inference]

pattern recognition receptor activity

lipoteichoic acid immune receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MELGGAAGALGPSGPLLVCLCFGTLAAQAADTCPEVKLVGLEGSDKLSILRGCPGLPGAPGLKGETGAAGLKGERGLPGVPGKAGPAGPKGSTGAQGEKGARGEKGESGQLHSCATGPRTCTELLTRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRKDGSVDFFRTWTAYKQGFGSQLGEFWLGNDNIHALTAQGTSELRVDLMDFEGNHRFAKYQSFRMADEAEKYKLVLGAFVEGNAGDSLTDHGNHFFSTKDRDNDESPSNCAAQFQGAWWYHSCHSSNLNGRYLRGPHTSYANGINWKSWGRYNYSYKVSEMKLRLT

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
316	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Ficolins bind to repetitive carbohydrate structures on the target cell surface	Bos taurus
Neutrophil degranulation	Bos taurus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements