GlyCosmos Portal

Submissions

R-spondin-2

Summary

UniProt ID: Q5M7L6
Gene Symbol: rspo2
Gene ID: 496854
Organism: Xenopus tropicalis (tropical clawed frog)

External Links

Re-Glyco: Q5M7L6

Annotation

Keyword: 3D-structure Developmental protein Disulfide bond Glycoprotein Heparin-binding Reference proteome Secreted Sensory transduction Signal Wnt signaling pathway

Gene Ontology (GO)

Displaying entries **1 - 5** of 15 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
skeletal system development
dorsal/ventral axis specification	IMP	PMID
dorsal/ventral axis specification	IEA	GO_REF
Wnt signaling pathway
BMP signaling pathway	IMP	PMID

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein serine/threonine kinase signaling pathway [inference]

transforming growth factor beta receptor superfamily signaling pathway [inference]

BMP signaling pathway

Wnt signaling pathway

metabolic process [inference]

catabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

protein catabolic process in the vacuole [inference]

lysosomal protein catabolic process

macromolecule metabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

protein catabolic process in the vacuole [inference]

lysosomal protein catabolic process

protein metabolic process [inference]

protein catabolic process [inference]

protein catabolic process in the vacuole [inference]

lysosomal protein catabolic process

primary metabolic process [inference]

protein metabolic process [inference]

protein catabolic process [inference]

protein catabolic process in the vacuole [inference]

lysosomal protein catabolic process

multicellular organismal process [inference]

pattern specification process [inference]

axis specification [inference]

dorsal/ventral axis specification

developmental process [inference]

anatomical structure development [inference]

system development [inference]

skeletal system development

appendage development [inference]

fin development [inference]

medial fin development [inference]

limb development [inference]

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of BMP signaling pathway

regulation of Wnt signaling pathway [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

regulation of canonical Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of BMP signaling pathway [inference]

negative regulation of BMP signaling pathway

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of BMP signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of BMP signaling pathway

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of BMP signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of BMP signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of BMP signaling pathway

negative regulation of cellular response to growth factor stimulus [inference]

negative regulation of BMP signaling pathway

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of BMP signaling pathway

regulation of Wnt signaling pathway [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

regulation of canonical Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of BMP signaling pathway [inference]

negative regulation of BMP signaling pathway

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of BMP signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of BMP signaling pathway

negative regulation of cellular response to growth factor stimulus [inference]

negative regulation of BMP signaling pathway

regulation of cellular response to growth factor stimulus [inference]

regulation of BMP signaling pathway [inference]

negative regulation of BMP signaling pathway

negative regulation of cellular response to growth factor stimulus [inference]

negative regulation of BMP signaling pathway

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein serine/threonine kinase signaling pathway [inference]

transforming growth factor beta receptor superfamily signaling pathway [inference]

BMP signaling pathway

Wnt signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of BMP signaling pathway

regulation of Wnt signaling pathway [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

regulation of canonical Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of BMP signaling pathway [inference]

negative regulation of BMP signaling pathway

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of BMP signaling pathway

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of BMP signaling pathway

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of BMP signaling pathway

Displaying **all 2** entries
GO Term	Evidence Code	Reference
obsolete extracellular space
lysosome	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

Displaying **all 3** entries
GO Term	Evidence Code	Reference
heparin binding
BMP receptor binding	IDA	PMID
BMP receptor binding	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

receptor serine/threonine kinase binding [inference]

transmembrane receptor protein serine/threonine kinase binding [inference]

BMP receptor binding

carbohydrate derivative binding [inference]

glycosaminoglycan binding [inference]

heparin binding

sulfur compound binding [inference]

heparin binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MQFQLFSFVLIILNCVDYSHCQANRWRRSKRASYGTNPICKGCLSCSKDNGCLRCQPKLFFYLRREGMRQYGECLQSCPPGYYGVRGPDMNRCSRCRIENCDSCFSRDFCIKCKSGFYSHKGQCFEECPEGFAPLDDTMVCVDGCEVGPWSEWGTCSRNNRTCGFKWGLETRTRQIVKKPAKDTIPCPTIAESRRCKMAMRHCPGGTRTTKKKDKKNKKKKKKLLERAQEQHSVVLATDRSSQ

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites