GlyCosmos Portal

Submissions

Neutral amino acid transporter 9

Summary

UniProt ID: Q5M7S0
Gene Symbol: slc38a9
Gene ID: 496801
Organism: Xenopus tropicalis (tropical clawed frog)

External Links

Re-Glyco: Q5M7S0

Annotation

Keyword: Amino-acid transport Disulfide bond Endosome Glycoprotein Lysosome Metal-binding Reference proteome Sodium Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
amino acid transmembrane transport	ISS	GO_REF
amino acid transmembrane transport	IBA	GO_REF
asparagine transport	ISS	GO_REF
L-glutamine transport	ISS	GO_REF
positive regulation of TOR signaling	ISS	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to acid chemical [inference]

cellular response to amino acid stimulus

transmembrane transport [inference]

amino acid transmembrane transport

L-alpha-amino acid transmembrane transport [inference]

L-arginine transmembrane transport

basic amino acid transmembrane transport [inference]

L-arginine transmembrane transport

carboxylic acid transmembrane transport [inference]

L-alpha-amino acid transmembrane transport [inference]

L-arginine transmembrane transport

response to stimulus [inference]

response to chemical [inference]

response to acid chemical [inference]

response to amino acid [inference]

cellular response to amino acid stimulus

cellular response to acid chemical [inference]

cellular response to amino acid stimulus

cellular response to chemical stimulus [inference]

cellular response to acid chemical [inference]

cellular response to amino acid stimulus

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to acid chemical [inference]

cellular response to amino acid stimulus

localization [inference]

establishment of localization [inference]

transport [inference]

amino acid transport [inference]

amino acid transmembrane transport

L-alpha-amino acid transmembrane transport [inference]

L-arginine transmembrane transport

basic amino acid transmembrane transport [inference]

L-arginine transmembrane transport

basic amino acid transport [inference]

basic amino acid transmembrane transport [inference]

L-arginine transmembrane transport

neutral amino acid transport [inference]

L-amino acid transport [inference]

L-glutamine transport

L-alpha-amino acid transmembrane transport [inference]

L-arginine transmembrane transport

organic cation transport [inference]

organic anion transport [inference]

carboxylic acid transport [inference]

asparagine transport

L-amino acid transport [inference]

L-glutamine transport

L-alpha-amino acid transmembrane transport [inference]

L-arginine transmembrane transport

carboxylic acid transmembrane transport [inference]

L-alpha-amino acid transmembrane transport [inference]

L-arginine transmembrane transport

organic acid transport [inference]

carboxylic acid transport [inference]

asparagine transport

L-amino acid transport [inference]

L-glutamine transport

L-alpha-amino acid transmembrane transport [inference]

L-arginine transmembrane transport

carboxylic acid transmembrane transport [inference]

L-alpha-amino acid transmembrane transport [inference]

L-arginine transmembrane transport

transmembrane transport [inference]

amino acid transmembrane transport

L-alpha-amino acid transmembrane transport [inference]

L-arginine transmembrane transport

basic amino acid transmembrane transport [inference]

L-arginine transmembrane transport

carboxylic acid transmembrane transport [inference]

L-alpha-amino acid transmembrane transport [inference]

L-arginine transmembrane transport

nitrogen compound transport [inference]

asparagine transport

L-amino acid transport [inference]

L-glutamine transport

L-alpha-amino acid transmembrane transport [inference]

L-arginine transmembrane transport

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of TOR signaling

positive regulation of TORC1 signaling

regulation of intracellular signal transduction [inference]

regulation of TOR signaling [inference]

positive regulation of TOR signaling

positive regulation of TORC1 signaling

regulation of TORC1 signaling [inference]

positive regulation of TORC1 signaling

positive regulation of intracellular signal transduction [inference]

positive regulation of TOR signaling

positive regulation of TORC1 signaling

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of TOR signaling

positive regulation of TORC1 signaling

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of TOR signaling

positive regulation of TORC1 signaling

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of TOR signaling

positive regulation of TORC1 signaling

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of TOR signaling

positive regulation of TORC1 signaling

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of TOR signaling

positive regulation of TORC1 signaling

regulation of intracellular signal transduction [inference]

regulation of TOR signaling [inference]

positive regulation of TOR signaling

positive regulation of TORC1 signaling

regulation of TORC1 signaling [inference]

positive regulation of TORC1 signaling

positive regulation of intracellular signal transduction [inference]

positive regulation of TOR signaling

positive regulation of TORC1 signaling

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of TOR signaling

positive regulation of TORC1 signaling

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of TOR signaling

positive regulation of TORC1 signaling

regulation of intracellular signal transduction [inference]

regulation of TOR signaling [inference]

positive regulation of TOR signaling

positive regulation of TORC1 signaling

regulation of TORC1 signaling [inference]

positive regulation of TORC1 signaling

positive regulation of intracellular signal transduction [inference]

positive regulation of TOR signaling

positive regulation of TORC1 signaling

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of TOR signaling

positive regulation of TORC1 signaling

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of TOR signaling

positive regulation of TORC1 signaling

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
lysosome	ISS	GO_REF
lysosomal membrane	ISS	GO_REF
lysosomal membrane	IBA	GO_REF
lysosomal membrane	IEA	GO_REF
late endosome	ISS	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

vesicle membrane [inference]

cytoplasmic vesicle membrane [inference]

endosome membrane [inference]

late endosome membrane

bounding membrane of organelle [inference]

vacuolar membrane [inference]

lytic vacuole membrane [inference]

lysosomal membrane

endosome membrane [inference]

late endosome membrane

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

late endosome

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

late endosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

late endosome

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
guanyl-nucleotide exchange factor activity	ISS	GO_REF
amino acid transmembrane transporter activity	ISS	GO_REF
L-amino acid transmembrane transporter activity	IBA	GO_REF
L-asparagine transmembrane transporter activity	ISS	GO_REF
L-glutamine transmembrane transporter activity	ISS	GO_REF

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity [inference]

amino acid transmembrane transporter activity

basic amino acid transmembrane transporter activity [inference]

L-arginine transmembrane transporter activity

neutral L-amino acid transmembrane transporter activity [inference]

L-amino acid transmembrane transporter activity

carboxylic acid transmembrane transporter activity [inference]

L-amino acid transmembrane transporter activity

binding [inference]

lipid binding [inference]

steroid binding [inference]

sterol binding [inference]

cholesterol binding

amino acid binding [inference]

arginine binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

carboxylic acid binding [inference]

arginine binding

cation binding [inference]

organic acid binding [inference]

carboxylic acid binding [inference]

arginine binding

alcohol binding [inference]

cholesterol binding

molecular function regulator activity [inference]

enzyme regulator activity [inference]

nucleoside-triphosphatase regulator activity [inference]

GTPase regulator activity [inference]

guanyl-nucleotide exchange factor activity

molecular sensor activity [inference]

lipid sensor activity [inference]

sterol sensor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MDSDQTPLINPSLFEECAQNHFAATDPRSRRPFHIEPSYITSINDDDPQRITSVASAMNKRIHYYSKLSNPSDKGLIAPDHVLPAPEEIYVYSPLGTALKIDGSDGTGKNSSIVTIFMIWNTMMGTSILSIPWGIKQAGFTTGVCILFLMGILTLYCCYRVVKSRGTIPLTDTSNWEFPDVCQYYFGSFGRWSSLLFSLVSLIGAMIVYWVLMSNFLFNTGKFIYNYVNDVNVTDDVLSNNGSDKVICPNPDSTRPLNKSMDTYFGNGTNYEQFETWWSKTNTVPFYLVVLLLPLLSFRSPSFFAKFNILGTVSIIYLVSLVTLKAAHLGFHLRFSWNQVQEFFVPEFRLSFPQLTGILTLAFFIHNCIITLLKNNRNQKNNVRDLSIAYLLVGLTYIYVGVAVFASFPSPPLSKQCIQQNFLDNFPSSDILAFVARIFLLFQMMTVYPLLGYLVRVQLLGHIFGDIYPSVFHVLALNIAVVGVGVIMARFYPNIGGIIRFSGAACGLAFVFVYPSLIHMISLHRRGQLKVHSILIHVSIIVLGIANLIAQFFM

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	Source
232	N-linked (GlcNAc...) asparagine	UniProt
241	N-linked (GlcNAc...) asparagine	UniProt
258	N-linked (GlcNAc...) asparagine	UniProt
267	N-linked (GlcNAc...) asparagine	UniProt