GlyCosmos Portal

Submissions

Protein-tyrosine sulfotransferase 2

Summary

UniProt ID: Q5RJS8
Gene Symbol: Tpst2
Gene ID
Organism: Rattus norvegicus (Norway rat)

External Links

Re-Glyco: Q5RJS8

Annotation

Keyword: Disulfide bond Glycoprotein Golgi apparatus Reference proteome Signal-anchor Transferase Transmembrane helix

Gene Ontology (GO)

Displaying **all 4** entries
GO Term	Evidence Code	Reference
peptidyl-tyrosine sulfation	ISS	GO_REF
peptidyl-tyrosine sulfation	ISO	GO_REF
fusion of sperm to egg plasma membrane involved in single fertilization	ISO	GO_REF
prevention of polyspermy	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

sulfur compound metabolic process [inference]

sulfation [inference]

protein sulfation [inference]

peptidyl-tyrosine sulfation

macromolecule metabolic process [inference]

protein metabolic process [inference]

protein modification process [inference]

protein sulfation [inference]

peptidyl-tyrosine sulfation

peptidyl-amino acid modification [inference]

peptidyl-tyrosine modification [inference]

peptidyl-tyrosine sulfation

macromolecule modification [inference]

protein modification process [inference]

protein sulfation [inference]

peptidyl-tyrosine sulfation

peptidyl-amino acid modification [inference]

peptidyl-tyrosine modification [inference]

peptidyl-tyrosine sulfation

primary metabolic process [inference]

protein metabolic process [inference]

protein modification process [inference]

protein sulfation [inference]

peptidyl-tyrosine sulfation

peptidyl-amino acid modification [inference]

peptidyl-tyrosine modification [inference]

peptidyl-tyrosine sulfation

cellular process involved in reproduction in multicellular organism [inference]

fusion of sperm to egg plasma membrane involved in single fertilization

reproductive process [inference]

multicellular organismal reproductive process [inference]

cellular process involved in reproduction in multicellular organism [inference]

fusion of sperm to egg plasma membrane involved in single fertilization

biological regulation [inference]

regulation of biological process [inference]

negative regulation of biological process [inference]

negative regulation of reproductive process [inference]

negative regulation of fertilization [inference]

prevention of polyspermy

regulation of reproductive process [inference]

regulation of fertilization [inference]

negative regulation of fertilization [inference]

prevention of polyspermy

negative regulation of reproductive process [inference]

negative regulation of fertilization [inference]

prevention of polyspermy

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
Golgi membrane	ISS	GO_REF
Golgi membrane	ISO	GO_REF
Golgi membrane	IEA	GO_REF
endoplasmic reticulum	ISO	GO_REF
Golgi apparatus	IBA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

bounding membrane of organelle [inference]

Golgi membrane

membrane-enclosed lumen [inference]

organelle lumen [inference]

intracellular organelle lumen [inference]

Golgi lumen

organelle subcompartment [inference]

Golgi apparatus subcompartment [inference]

trans-Golgi network

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

Displaying **all 5** entries
GO Term	Evidence Code	Reference
protein-tyrosine sulfotransferase activity	ISS	GO_REF
protein-tyrosine sulfotransferase activity	ISO	GO_REF
protein-tyrosine sulfotransferase activity	IBA	GO_REF
protein-tyrosine sulfotransferase activity	IEA	GO_REF GO_REF GO_REF GO_REF
protein homodimerization activity	ISO	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

transferase activity, transferring sulphur-containing groups [inference]

sulfotransferase activity [inference]

protein-tyrosine sulfotransferase activity

catalytic activity, acting on a protein [inference]

protein-tyrosine sulfotransferase activity

binding [inference]

protein binding [inference]

identical protein binding [inference]

protein homodimerization activity

protein dimerization activity [inference]

protein homodimerization activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MRLSVRKVLLAVGCALALVLAVQLGQQVLECRAVLGGVRSPRRMQPEQEELVMLGADHVEYRYGKTMPLIFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWTKSGREKLRLDEAGVTDEVLDAAMQAFILEVIAKHGEPARVLCNKDPFTLKSSVYLARLFPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDCLTKWNKAIEVMYAQCMEVGRDKCLPVYYEQLVLHPRRSLKRILDFLGIAWSDTVLHHEDLIGKPGGVSLSKIERSTDQVIKPVNLEALSKWTGHIPRDVVRDMAQIAPMLARLGYDPYANPPNYGNPDPIVINNTHRVLKGDYKTPANLKGYFQVNQNSTSPHLGSS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
342	N-linked (GlcNAc...) asparagine			UniProt
367	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Cytosolic sulfonation of small molecules	Rattus norvegicus
Gamma carboxylation, hypusinylation, hydroxylation, and arylsulfatase activation	Rattus norvegicus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements