GlyCosmos Portal

Annotation

Keyword: Apoptosis Cell cycle Copper Endosome FAD Glycoprotein Heme Iron transport NADP Oxidoreductase Phosphoprotein Reference proteome Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
iron ion transport	ISO	GO_REF
apoptotic process
protein secretion	ISS	PMID
protein secretion	ISO	GO_REF
copper ion import	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cell death [inference]

programmed cell death [inference]

apoptotic process

vesicle-mediated transport [inference]

exocytosis [inference]

exosomal secretion

export from cell [inference]

secretion by cell [inference]

exocytosis [inference]

exosomal secretion

protein secretion

homeostatic process [inference]

cellular homeostasis [inference]

intracellular chemical homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular iron ion homeostasis [inference]

iron import into cell

chemical homeostasis [inference]

monoatomic ion homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular iron ion homeostasis [inference]

iron import into cell

monoatomic cation homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular iron ion homeostasis [inference]

iron import into cell

intracellular chemical homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular iron ion homeostasis [inference]

iron import into cell

inorganic ion homeostasis [inference]

intracellular iron ion homeostasis [inference]

iron import into cell

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein transport [inference]

protein secretion

protein localization to extracellular region [inference]

protein secretion

establishment of localization [inference]

transport [inference]

monoatomic ion transport [inference]

monoatomic cation transport [inference]

metal ion transport [inference]

transition metal ion transport [inference]

copper ion transport [inference]

copper ion import

iron ion transport

iron import into cell

protein transport [inference]

protein secretion

vesicle-mediated transport [inference]

exocytosis [inference]

exosomal secretion

secretion [inference]

secretion by cell [inference]

exocytosis [inference]

exosomal secretion

protein secretion

export from cell [inference]

secretion by cell [inference]

exocytosis [inference]

exosomal secretion

protein secretion

establishment of protein localization [inference]

protein transport [inference]

protein secretion

establishment of protein localization to extracellular region [inference]

protein secretion

establishment of localization in cell

iron import into cell

establishment of vesicle localization [inference]

exosomal secretion

establishment of organelle localization [inference]

establishment of vesicle localization [inference]

exosomal secretion

organelle localization [inference]

vesicle localization [inference]

establishment of vesicle localization [inference]

exosomal secretion

establishment of organelle localization [inference]

establishment of vesicle localization [inference]

exosomal secretion

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of signal transduction by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

regulation of intracellular signal transduction [inference]

regulation of signal transduction by p53 class mediator [inference]

positive regulation of signal transduction by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intracellular signal transduction [inference]

positive regulation of signal transduction by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of signal transduction by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of signal transduction by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of signal transduction by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of signal transduction by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of signal transduction by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

regulation of intracellular signal transduction [inference]

regulation of signal transduction by p53 class mediator [inference]

positive regulation of signal transduction by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intracellular signal transduction [inference]

positive regulation of signal transduction by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of signal transduction by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

regulation of response to stress [inference]

regulation of cellular response to stress [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of signal transduction by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

regulation of intracellular signal transduction [inference]

regulation of signal transduction by p53 class mediator [inference]

positive regulation of signal transduction by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intracellular signal transduction [inference]

positive regulation of signal transduction by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of signal transduction by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

positive regulation of apoptotic process

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of signal transduction by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

regulation of cellular response to stress [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
cytoplasm	ISO	GO_REF
endosome	ISO	GO_REF
endosome	IBA	GO_REF
multivesicular body	ISO	GO_REF
plasma membrane	ISO	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cytoplasm

membrane [inference]

plasma membrane

organelle membrane [inference]

vesicle membrane [inference]

cytoplasmic vesicle membrane [inference]

endosome membrane

bounding membrane of organelle [inference]

endosome membrane

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

late endosome [inference]

multivesicular body

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

late endosome [inference]

multivesicular body

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

late endosome [inference]

multivesicular body

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
ferric-chelate reductase activity	ISO	GO_REF
cupric reductase (NADH) activity	ISO	GO_REF
cupric reductase (NADH) activity	IBA	GO_REF
heme binding	ISS	GO_REF
heme binding	ISO	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

oxidoreductase activity [inference]

oxidoreductase activity, acting on metal ions [inference]

ferric-chelate reductase activity

ferric-chelate reductase (NADPH) activity

oxidoreductase activity, acting on metal ions, NAD or NADP as acceptor [inference]

binding [inference]

protein binding [inference]

identical protein binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

flavin adenine dinucleotide binding [inference]

FAD binding

cation binding [inference]

metal ion binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

flavin adenine dinucleotide binding [inference]

FAD binding

tetrapyrrole binding [inference]

heme binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

flavin adenine dinucleotide binding [inference]

FAD binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MSGEMDKPLISRRLVDSDGSLAEVPKEAPKVGILGSGDFARSLATRLVGSGFSVVVGSRNPKRTAGLFPSLAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLADQLAGKILVDVSNPTEKERLQHRQSNAEYLASLFPACTVVKAFNVISAWALQAGPRDGNRQVLICGDQLEAKHTVSEMARAMGFTPLDMGSLASAREVEAIPLRLLPSWKVPTLLALGLFVCFYAYNFIRDVLQPYIRKDENKFYKMPLSVVNTTLPCVAYVLLSLVYLPGVLAAALQLRRGTKYQRFPDWLDHWLQHRKQIGLLSFFFAMLHALYSFCLPLRRSHRYDLVNLAVKQVLANKSRLWVEEEVWRMEIYLSLGVLALGMLSLLAVTSIPSIANSLNWKEFSFVQSTLGFVALMLSTMHTLTYGWTRAFEENHYKFYLPPTFTLTLLLPCVIILAKGLFLLPCLSHRLTKIRRGWERDGAVKFMLPAGHTQGEKTSHV

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
256	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 4** entries
Pathway Name	Organism
RHOF GTPase cycle	Rattus norvegicus
RHOQ GTPase cycle	Rattus norvegicus
TP53 Regulates Transcription of Genes Involved in Cytochrome C Release	Rattus norvegicus
Transferrin endocytosis and recycling	Rattus norvegicus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements