GlyCosmos Portal

Submissions

PILR alpha-associated neural protein

Summary

UniProt ID: Q5U2P6
Gene Symbol: Panp Pianp
Gene ID: 312711
Organism: Rattus norvegicus (Norway rat)

External Links

Re-Glyco: Q5U2P6

Annotation

Keyword: Glycoprotein Reference proteome Signal Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
response to stress	ISO	GO_REF
gamma-aminobutyric acid signaling pathway	ISO	GO_REF
visual learning	ISO	GO_REF
gene expression	ISO	GO_REF
glutamate secretion	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cell communication [inference]

cell-cell signaling [inference]

gamma-aminobutyric acid signaling pathway

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

gene expression

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

gene expression

export from cell [inference]

secretion by cell [inference]

glutamate secretion

multicellular organismal process [inference]

system process [inference]

nervous system process [inference]

cognition [inference]

learning or memory [inference]

learning [inference]

associative learning [inference]

visual learning

behavior [inference]

learning or memory [inference]

learning [inference]

associative learning [inference]

visual learning

visual behavior [inference]

visual learning

social behavior

multicellular organismal-level homeostasis [inference]

homeostasis of number of cells

developmental process [inference]

anatomical structure development [inference]

homeostatic process [inference]

multicellular organismal-level homeostasis [inference]

homeostasis of number of cells

response to stimulus [inference]

response to stress

response to abiotic stimulus [inference]

response to radiation [inference]

response to light stimulus [inference]

visual behavior [inference]

visual learning

localization [inference]

establishment of localization [inference]

transport [inference]

amino acid transport [inference]

acidic amino acid transport [inference]

glutamate secretion

organic anion transport [inference]

carboxylic acid transport [inference]

dicarboxylic acid transport [inference]

glutamate secretion

organic acid transport [inference]

carboxylic acid transport [inference]

dicarboxylic acid transport [inference]

glutamate secretion

secretion [inference]

secretion by cell [inference]

glutamate secretion

nitrogen compound transport [inference]

glutamate secretion

export from cell [inference]

secretion by cell [inference]

glutamate secretion

biological process involved in intraspecies interaction between organisms [inference]

social behavior

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

regulation of immune response

signaling [inference]

cell-cell signaling [inference]

gamma-aminobutyric acid signaling pathway

regulation of response to stimulus [inference]

regulation of immune response

Displaying **all 4** entries
GO Term	Evidence Code	Reference
membrane	IBA	GO_REF
membrane	IEA	GO_REF
basolateral plasma membrane	IDA	PMID
presynapse	ISO	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane

plasma membrane region [inference]

basolateral plasma membrane

presynapse

Displaying 1 entry
GO Term	Evidence Code	Reference
protein domain specific binding	ISO	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

protein domain specific binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MWPAQLLSQLLPLWPLLLLPLSLPAQGSSHRSPPAPARPPCVRGGPSAPRHVCVWERAPPPSRSPRVPRSRRQVLPGTAPPATPSGFEEGPPSSQYPWAIVWGPTVSREDGGDPNSVNPGFLPLDYGFAAPHGLATPHPNSDSMRDDGDGLILGETPATLRPFLFGGRGEGVDPQLYVTITISIIIVLVATGIIFKFCWDRSQKRRRPSGQQGALRQEESQQPLTDLSPAGVTVLGAFGDSPTPTPDHEEPRGGPRPGMPQPKGAPAFQLNR

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
136	O-linked (GalNAc...) threonine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell	Rattus norvegicus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements