GlyCosmos Portal

Submissions

Eukaryotic translation initiation factor 4E-binding protein 1

Summary

UniProt ID: Q60876
Gene Symbol: Eif4ebp1
Gene ID: 13685
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q60876
PubChem: Q60876
The O-GlcNAc Database: Q60876
O-GlcNAcAtlas: Q60876
Re-Glyco: Q60876

Annotation

Keyword: Acetylation Cytoplasm Isopeptide bond Nucleus Phosphoprotein Protein synthesis inhibitor Reference proteome Translation regulation Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 16 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
G1/S transition of mitotic cell cycle	ISO	GO_REF
IRES-dependent translational initiation of linear mRNA	IDA	PMID
regulation of translational initiation	TAS	PMID
insulin receptor signaling pathway	IDA	PMID
negative regulation of translation	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

insulin receptor signaling pathway

intracellular signal transduction [inference]

TOR signaling

metabolic process [inference]

translational initiation [inference]

cytoplasmic translational initiation [inference]

cap-independent translational initiation [inference]

cap-independent translational initiation of linear mRNA [inference]

IRES-dependent translational initiation of linear mRNA

cell cycle process [inference]

cell cycle phase transition [inference]

mitotic cell cycle phase transition [inference]

G1/S transition of mitotic cell cycle

cell cycle G1/S phase transition [inference]

G1/S transition of mitotic cell cycle

mitotic cell cycle process [inference]

mitotic cell cycle phase transition [inference]

G1/S transition of mitotic cell cycle

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to hypoxia

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus [inference]

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus [inference]

cellular response to dexamethasone stimulus

cellular response to lipid [inference]

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus [inference]

cellular response to dexamethasone stimulus

cellular response to oxygen levels [inference]

cellular response to decreased oxygen levels [inference]

cellular response to hypoxia

cellular response to oxygen-containing compound [inference]

cellular response to ketone [inference]

cellular response to dexamethasone stimulus

response to stimulus [inference]

response to stress [inference]

response to hypoxia [inference]

cellular response to hypoxia

cellular response to stress [inference]

cellular response to hypoxia

response to starvation [inference]

response to amino acid starvation

response to abiotic stimulus [inference]

response to oxygen levels [inference]

response to decreased oxygen levels [inference]

response to hypoxia [inference]

cellular response to hypoxia

cellular response to decreased oxygen levels [inference]

cellular response to hypoxia

cellular response to oxygen levels [inference]

cellular response to decreased oxygen levels [inference]

cellular response to hypoxia

response to endogenous stimulus [inference]

response to hormone [inference]

cellular response to hormone stimulus [inference]

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus [inference]

cellular response to dexamethasone stimulus

response to steroid hormone [inference]

response to corticosteroid [inference]

response to glucocorticoid [inference]

cellular response to glucocorticoid stimulus [inference]

cellular response to dexamethasone stimulus

response to dexamethasone [inference]

cellular response to dexamethasone stimulus

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus [inference]

cellular response to dexamethasone stimulus

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus [inference]

cellular response to dexamethasone stimulus

cellular response to endogenous stimulus [inference]

cellular response to hormone stimulus [inference]

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus [inference]

cellular response to dexamethasone stimulus

response to nutrient levels [inference]

response to starvation [inference]

response to amino acid starvation

response to chemical [inference]

response to hormone [inference]

cellular response to hormone stimulus [inference]

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus [inference]

cellular response to dexamethasone stimulus

response to steroid hormone [inference]

response to corticosteroid [inference]

response to glucocorticoid [inference]

cellular response to glucocorticoid stimulus [inference]

cellular response to dexamethasone stimulus

response to dexamethasone [inference]

cellular response to dexamethasone stimulus

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus [inference]

cellular response to dexamethasone stimulus

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus [inference]

cellular response to dexamethasone stimulus

response to lipid [inference]

response to steroid hormone [inference]

response to corticosteroid [inference]

response to glucocorticoid [inference]

cellular response to glucocorticoid stimulus [inference]

cellular response to dexamethasone stimulus

response to dexamethasone [inference]

cellular response to dexamethasone stimulus

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus [inference]

cellular response to dexamethasone stimulus

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus [inference]

cellular response to dexamethasone stimulus

cellular response to lipid [inference]

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus [inference]

cellular response to dexamethasone stimulus

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus [inference]

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus [inference]

cellular response to dexamethasone stimulus

cellular response to lipid [inference]

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus [inference]

cellular response to dexamethasone stimulus

cellular response to oxygen levels [inference]

cellular response to decreased oxygen levels [inference]

cellular response to hypoxia

cellular response to oxygen-containing compound [inference]

cellular response to ketone [inference]

cellular response to dexamethasone stimulus

response to oxygen-containing compound [inference]

response to ketone [inference]

response to dexamethasone [inference]

cellular response to dexamethasone stimulus

cellular response to ketone [inference]

cellular response to dexamethasone stimulus

cellular response to oxygen-containing compound [inference]

cellular response to ketone [inference]

cellular response to dexamethasone stimulus

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to hypoxia

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus [inference]

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus [inference]

cellular response to dexamethasone stimulus

cellular response to lipid [inference]

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus [inference]

cellular response to dexamethasone stimulus

cellular response to oxygen levels [inference]

cellular response to decreased oxygen levels [inference]

cellular response to hypoxia

cellular response to oxygen-containing compound [inference]

cellular response to ketone [inference]

cellular response to dexamethasone stimulus

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of cell cycle [inference]

positive regulation of mitotic cell cycle

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of translation

negative regulation of translational initiation

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of translation

negative regulation of translational initiation

negative regulation of protein metabolic process [inference]

negative regulation of translation

negative regulation of translational initiation

negative regulation of cellular component organization [inference]

negative regulation of protein-containing complex assembly

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

insulin receptor signaling pathway

intracellular signal transduction [inference]

TOR signaling

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of translation

negative regulation of translational initiation

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

post-transcriptional regulation of gene expression [inference]

regulation of translation [inference]

regulation of translational initiation

negative regulation of translational initiation

negative regulation of translation

negative regulation of translational initiation

negative regulation of gene expression [inference]

negative regulation of translation

negative regulation of translational initiation

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of translation

negative regulation of translational initiation

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of translation

negative regulation of translational initiation

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of translation

negative regulation of translational initiation

negative regulation of protein metabolic process [inference]

negative regulation of translation

negative regulation of translational initiation

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

post-transcriptional regulation of gene expression [inference]

regulation of translation [inference]

regulation of translational initiation

negative regulation of translational initiation

negative regulation of translation

negative regulation of translational initiation

negative regulation of gene expression [inference]

negative regulation of translation

negative regulation of translational initiation

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of translation

negative regulation of translational initiation

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of translation

negative regulation of translational initiation

negative regulation of protein metabolic process [inference]

negative regulation of translation

negative regulation of translational initiation

regulation of protein metabolic process [inference]

regulation of translation [inference]

regulation of translational initiation

negative regulation of translational initiation

negative regulation of translation

negative regulation of translational initiation

negative regulation of protein metabolic process [inference]

negative regulation of translation

negative regulation of translational initiation

regulation of primary metabolic process [inference]

regulation of protein metabolic process [inference]

regulation of translation [inference]

regulation of translational initiation

negative regulation of translational initiation

negative regulation of translation

negative regulation of translational initiation

negative regulation of protein metabolic process [inference]

negative regulation of translation

negative regulation of translational initiation

regulation of cellular component biogenesis [inference]

regulation of protein-containing complex assembly [inference]

negative regulation of protein-containing complex assembly

positive regulation of cellular process [inference]

positive regulation of cell cycle [inference]

positive regulation of mitotic cell cycle

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of translation

negative regulation of translational initiation

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of translation

negative regulation of translational initiation

negative regulation of protein metabolic process [inference]

negative regulation of translation

negative regulation of translational initiation

negative regulation of cellular component organization [inference]

negative regulation of protein-containing complex assembly

regulation of cellular component organization [inference]

regulation of protein-containing complex assembly [inference]

negative regulation of protein-containing complex assembly

negative regulation of cellular component organization [inference]

negative regulation of protein-containing complex assembly

regulation of cell cycle [inference]

regulation of mitotic cell cycle [inference]

positive regulation of mitotic cell cycle

positive regulation of cell cycle [inference]

positive regulation of mitotic cell cycle

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
nucleus	ISO	GO_REF
nucleus	EXP	PMID
nucleus	IEA	GO_REF
cytoplasm	ISO	GO_REF
cytoplasm	EXP	PMID

GO Hierarchy

cellular component

protein-containing complex

cellular anatomical structure [inference]

cytoplasm

cytosol

postsynaptic cytosol

cell junction [inference]

synapse [inference]

glutamatergic synapse

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
eukaryotic initiation factor 4E binding	ISO	GO_REF GO_REF
eukaryotic initiation factor 4E binding	IBA	GO_REF
eukaryotic initiation factor 4E binding	IPI	PMID
eukaryotic initiation factor 4E binding	IEA	GO_REF
translation repressor activity	ISS	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

enzyme binding [inference]

phosphatase binding [inference]

protein phosphatase binding [inference]

protein phosphatase 2A binding

translation initiation factor binding

eukaryotic initiation factor 4E binding

translation regulator activity [inference]

translation repressor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MSAGSSCSQTPSRAIPTRRVALGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVAKTPPKDLPAIPGVTSPTSDEPPMQASQSQLPSSPEDKRAGGEESQFEMDI

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	PubMed ID	GlyTouCan ID	Source
10		G49108TO	GlyGen
12		G49108TO	GlyGen
81	21840999	G49108TO	The O-GlcNAc Database

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S	Mus musculus
mTORC1-mediated signalling	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements