GlyCosmos Portal

Submissions

Non-selective voltage-gated ion channel VDAC2

Summary

UniProt ID: Q60930
Gene Symbol: Vdac2 Vdac6
Gene ID: 22334
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q60930
PubChem: Q60930
RaftProt: Q60930
Re-Glyco: Q60930

Annotation

Keyword: ATP-binding Acetylation Direct protein sequencing Isopeptide bond Lipid transport Lipid-binding Mitochondrion outer membrane NAD Phosphoprotein Porin Reference proteome Transmembrane beta strand Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
anion transport	ISS	GO_REF
monoatomic anion transport	ISS	GO_REF
anion transport	ISO	GO_REF
monoatomic anion transport	ISO	GO_REF
binding of sperm to zona pellucida	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cell recognition [inference]

cell-cell recognition [inference]

sperm-egg recognition [inference]

binding of sperm to zona pellucida

cellular localization [inference]

intracellular transport [inference]

mitochondrial transport [inference]

mitochondrial transmembrane transport

transmembrane transport [inference]

mitochondrial transmembrane transport

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

mitochondrion organization [inference]

apoptotic mitochondrial changes [inference]

regulation of mitochondrial membrane permeability involved in apoptotic process [inference]

positive regulation of mitochondrial membrane permeability involved in apoptotic process [inference]

mitochondrial outer membrane permeabilization

membrane organization [inference]

regulation of membrane lipid distribution [inference]

lipid translocation [inference]

phospholipid translocation

localization [inference]

establishment of localization [inference]

transport [inference]

monoatomic ion transport [inference]

monoatomic anion transport

lipid transport [inference]

phospholipid transport [inference]

phospholipid translocation

lipid translocation [inference]

phospholipid translocation

organophosphate ester transport [inference]

phospholipid transport [inference]

phospholipid translocation

intracellular transport [inference]

mitochondrial transport [inference]

mitochondrial transmembrane transport

transmembrane transport [inference]

mitochondrial transmembrane transport

establishment of localization in cell [inference]

intracellular transport [inference]

mitochondrial transport [inference]

mitochondrial transmembrane transport

cellular localization [inference]

intracellular transport [inference]

mitochondrial transport [inference]

mitochondrial transmembrane transport

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of cellular component organization [inference]

negative regulation of protein-containing complex assembly [inference]

negative regulation of protein polymerization

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of cellular component biogenesis [inference]

regulation of protein-containing complex assembly [inference]

negative regulation of protein-containing complex assembly [inference]

negative regulation of protein polymerization

regulation of protein polymerization [inference]

negative regulation of protein polymerization

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of cellular component organization [inference]

negative regulation of protein-containing complex assembly [inference]

negative regulation of protein polymerization

regulation of cellular component organization [inference]

regulation of protein-containing complex assembly [inference]

negative regulation of protein-containing complex assembly [inference]

negative regulation of protein polymerization

regulation of protein polymerization [inference]

negative regulation of protein polymerization

negative regulation of cellular component organization [inference]

negative regulation of protein-containing complex assembly [inference]

negative regulation of protein polymerization

regulation of biological quality [inference]

regulation of membrane permeability [inference]

regulation of mitochondrial membrane permeability [inference]

positive regulation of mitochondrial membrane permeability [inference]

mitochondrial outer membrane permeabilization involved in programmed cell death [inference]

positive regulation of mitochondrial membrane permeability involved in apoptotic process [inference]

mitochondrial outer membrane permeabilization

regulation of mitochondrial membrane permeability involved in apoptotic process [inference]

positive regulation of mitochondrial membrane permeability involved in apoptotic process [inference]

mitochondrial outer membrane permeabilization

positive regulation of membrane permeability [inference]

positive regulation of mitochondrial membrane permeability [inference]

mitochondrial outer membrane permeabilization involved in programmed cell death [inference]

positive regulation of mitochondrial membrane permeability involved in apoptotic process [inference]

mitochondrial outer membrane permeabilization

regulation of membrane lipid distribution [inference]

lipid translocation [inference]

phospholipid translocation

Displaying entries **1 - 5** of 18 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
acrosomal vesicle	ISO	GO_REF
mitochondrion	ISO	GO_REF
mitochondrion	IMP	PMID
mitochondrion	HDA	PMID
mitochondrial outer membrane	ISS	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

membrane protein complex [inference]

pore complex

cellular anatomical structure [inference]

nucleoid [inference]

mitochondrial nucleoid

membrane

outer membrane [inference]

organelle outer membrane [inference]

mitochondrial outer membrane

organelle membrane [inference]

organelle inner membrane [inference]

mitochondrial inner membrane

mitochondrial membrane

bounding membrane of organelle [inference]

organelle outer membrane [inference]

mitochondrial outer membrane

membrane microdomain [inference]

membrane raft

myelin sheath

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

transport vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

secretory vesicle [inference]

secretory granule [inference]

acrosomal vesicle

exocytic vesicle [inference]

synaptic vesicle

intracellular membrane-bounded organelle [inference]

mitochondrion

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

transport vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

secretory vesicle [inference]

secretory granule [inference]

acrosomal vesicle

exocytic vesicle [inference]

synaptic vesicle

membraneless organelle [inference]

intracellular membraneless organelle [inference]

mitochondrial nucleoid

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

transport vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

secretory vesicle [inference]

secretory granule [inference]

acrosomal vesicle

exocytic vesicle [inference]

synaptic vesicle

intracellular membraneless organelle [inference]

mitochondrial nucleoid

sperm midpiece

Displaying entries **1 - 5** of 15 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
voltage-gated monoatomic ion channel activity	ISS	GO_REF
voltage-gated monoatomic ion channel activity	ISO	GO_REF
voltage-gated monoatomic ion channel activity	IDA	PMID
ATP binding
oxysterol binding	IMP	PMID

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity [inference]

monoatomic ion transmembrane transporter activity [inference]

monoatomic ion channel activity [inference]

voltage-gated monoatomic ion channel activity

voltage-gated monoatomic anion channel activity

monoatomic anion channel activity [inference]

voltage-gated monoatomic anion channel activity

monoatomic anion transmembrane transporter activity [inference]

monoatomic anion channel activity [inference]

voltage-gated monoatomic anion channel activity

passive transmembrane transporter activity [inference]

channel activity [inference]

monoatomic ion channel activity [inference]

voltage-gated monoatomic ion channel activity

voltage-gated monoatomic anion channel activity

monoatomic anion channel activity [inference]

voltage-gated monoatomic anion channel activity

wide pore channel activity [inference]

porin activity

gated channel activity [inference]

voltage-gated channel activity [inference]

voltage-gated monoatomic ion channel activity

voltage-gated monoatomic anion channel activity

intramembrane lipid carrier activity [inference]

phospholipid scramblase activity

binding [inference]

lipid binding [inference]

steroid binding [inference]

sterol binding [inference]

phospholipid binding [inference]

phosphatidylcholine binding

sphingolipid binding [inference]

ceramide binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

ATP binding

cation binding [inference]

phosphatidylcholine binding

alcohol binding [inference]

cholesterol binding

quaternary ammonium group binding [inference]

phosphatidylcholine binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

molecular carrier activity [inference]

lipid carrier activity [inference]

intramembrane lipid carrier activity [inference]

phospholipid scramblase activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAECCVPVCPRPMCIPPPYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVSGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSAYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRSNFAVGYRTGDFQLHTNVNNGTEFGGSIYQKVCEDFDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSFNAGGHKLGLALELEA

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites