GlyCosmos Portal

Submissions

Non-selective voltage-gated ion channel VDAC3

Summary

UniProt ID: Q60931
Gene Symbol: Vdac3
Gene ID: 22335
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q60931
PubChem: Q60931
RaftProt: Q60931
Re-Glyco: Q60931

Annotation

Keyword: ATP-binding Acetylation Direct protein sequencing Isopeptide bond Mitochondrion outer membrane NAD Phosphoprotein Porin Reference proteome Spermatogenesis Transmembrane beta strand Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
behavioral fear response	IMP	PMID
chemical synaptic transmission	IMP	PMID
neuron-neuron synaptic transmission	IMP	PMID
spermatogenesis	IMP	PMID
learning	IMP	PMID

GO Hierarchy

biological process

cellular process [inference]

cell communication [inference]

cell-cell signaling [inference]

synaptic signaling [inference]

trans-synaptic signaling [inference]

anterograde trans-synaptic signaling [inference]

chemical synaptic transmission

neuron-neuron synaptic transmission

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cellular component assembly [inference]

sperm mitochondrial sheath assembly

reproductive process [inference]

developmental process involved in reproduction [inference]

spermatogenesis

multicellular organismal reproductive process [inference]

gamete generation [inference]

male gamete generation [inference]

spermatogenesis

multicellular organismal process [inference]

system process [inference]

nervous system process [inference]

cognition [inference]

learning or memory [inference]

learning

behavior [inference]

behavioral defense response [inference]

behavioral fear response

learning or memory [inference]

learning

multicellular organismal response to stress [inference]

fear response [inference]

behavioral fear response

developmental process [inference]

developmental process involved in reproduction [inference]

spermatogenesis

response to stimulus [inference]

response to stress [inference]

defense response [inference]

behavioral defense response [inference]

behavioral fear response

multicellular organismal response to stress [inference]

fear response [inference]

behavioral fear response

biological regulation [inference]

regulation of biological process [inference]

signaling [inference]

cell-cell signaling [inference]

synaptic signaling [inference]

trans-synaptic signaling [inference]

anterograde trans-synaptic signaling [inference]

chemical synaptic transmission

neuron-neuron synaptic transmission

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
mitochondrion	ISO	GO_REF
mitochondrion	IDA	PMID
mitochondrion	HDA	PMID PMID
mitochondrial outer membrane	ISS	GO_REF
mitochondrial outer membrane	IBA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

membrane protein complex [inference]

pore complex

cellular anatomical structure [inference]

membrane

outer membrane [inference]

organelle outer membrane [inference]

mitochondrial outer membrane

organelle membrane [inference]

organelle inner membrane [inference]

mitochondrial inner membrane

mitochondrial membrane [inference]

bounding membrane of organelle [inference]

organelle outer membrane [inference]

mitochondrial outer membrane

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

transport vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

secretory vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

intracellular membrane-bounded organelle [inference]

mitochondrion

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

transport vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

secretory vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

transport vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

secretory vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

Displaying **all 4** entries
GO Term	Evidence Code	Reference
nucleotide binding
voltage-gated monoatomic ion channel activity	ISO	GO_REF
voltage-gated monoatomic anion channel activity	IEA	GO_REF
porin activity

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity [inference]

monoatomic ion transmembrane transporter activity [inference]

monoatomic ion channel activity [inference]

voltage-gated monoatomic ion channel activity

voltage-gated monoatomic anion channel activity

monoatomic anion channel activity [inference]

voltage-gated monoatomic anion channel activity

monoatomic anion transmembrane transporter activity [inference]

monoatomic anion channel activity [inference]

voltage-gated monoatomic anion channel activity

passive transmembrane transporter activity [inference]

channel activity [inference]

monoatomic ion channel activity [inference]

voltage-gated monoatomic ion channel activity

voltage-gated monoatomic anion channel activity

monoatomic anion channel activity [inference]

voltage-gated monoatomic anion channel activity

wide pore channel activity [inference]

porin activity

gated channel activity [inference]

voltage-gated channel activity [inference]

voltage-gated monoatomic ion channel activity

voltage-gated monoatomic anion channel activity

binding [inference]

small molecule binding [inference]

heterocyclic compound binding [inference]

nucleotide binding

nucleoside phosphate binding [inference]

nucleotide binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MCNTPTYCDLGKAAKDVFNKGYGFGMVKIDLKTKSCSGVEFSTSGHAYTDTGKASGNLETKYKVCNYGLTFTQKWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYRRDCFSLGSNVDIDFSGPTIYGWAVLAFEGWLAGYQMSFDTAKSKLSQNNFALGYKAADFQLHTHVNDGTEFGGSIYQKVNERIETSINLAWTAGSNNTRFGIAAKYKLDCRTSLSAKVNNASLIGLGYTQTLRPGVKLTLSALIDGKNFNAGGHKVGLGFELEA

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites