GlyCosmos Portal

Submissions

Importin subunit alpha-5

Summary

UniProt ID: Q60960
Gene Symbol: Kpna1 Rch2
Gene ID: 16646
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q60960
PubChem: Q60960
Re-Glyco: Q60960

Annotation

Keyword: Acetylation Cytoplasm Nucleus Phosphoprotein Protein transport Reference proteome Repeat Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
protein import into nucleus	ISS	GO_REF
protein import into nucleus	IEA	GO_REF GO_REF
NLS-bearing protein import into nucleus	ISO	GO_REF GO_REF
NLS-bearing protein import into nucleus	IMP	PMID
NLS-bearing protein import into nucleus	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cell activation [inference]

skeletal muscle satellite cell activation [inference]

satellite cell activation involved in skeletal muscle regeneration

signal transduction [inference]

postsynaptic signal transduction [inference]

postsynapse to nucleus signaling pathway

cell population proliferation [inference]

muscle cell proliferation [inference]

striated muscle cell proliferation [inference]

skeletal muscle cell proliferation [inference]

skeletal muscle satellite cell proliferation

intercellular transport [inference]

import into nucleus [inference]

protein import into nucleus

NLS-bearing protein import into nucleus

cellular localization [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein import into nucleus

NLS-bearing protein import into nucleus

nuclear transport [inference]

nucleocytoplasmic transport [inference]

import into nucleus [inference]

protein import into nucleus

NLS-bearing protein import into nucleus

multicellular organismal process [inference]

cell activation [inference]

skeletal muscle satellite cell activation [inference]

satellite cell activation involved in skeletal muscle regeneration

developmental process [inference]

anatomical structure development [inference]

regeneration [inference]

tissue regeneration [inference]

skeletal muscle tissue regeneration

animal gross anatomical part developmental process [inference]

tissue regeneration [inference]

skeletal muscle tissue regeneration

growth [inference]

developmental growth [inference]

tissue regeneration [inference]

skeletal muscle tissue regeneration

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein transport [inference]

intracellular protein transport [inference]

protein import into nucleus

NLS-bearing protein import into nucleus

protein localization to organelle [inference]

protein localization to nucleus [inference]

protein import into nucleus

NLS-bearing protein import into nucleus

establishment of localization [inference]

transport [inference]

intercellular transport [inference]

import into nucleus [inference]

protein import into nucleus

NLS-bearing protein import into nucleus

protein transport [inference]

intracellular protein transport [inference]

protein import into nucleus

NLS-bearing protein import into nucleus

intracellular transport [inference]

intracellular protein transport [inference]

protein import into nucleus

NLS-bearing protein import into nucleus

nuclear transport [inference]

nucleocytoplasmic transport [inference]

import into nucleus [inference]

protein import into nucleus

NLS-bearing protein import into nucleus

establishment of protein localization [inference]

protein transport [inference]

intracellular protein transport [inference]

protein import into nucleus

NLS-bearing protein import into nucleus

establishment of protein localization to organelle [inference]

protein import into nucleus

NLS-bearing protein import into nucleus

establishment of localization in cell [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein import into nucleus

NLS-bearing protein import into nucleus

nuclear transport [inference]

nucleocytoplasmic transport [inference]

import into nucleus [inference]

protein import into nucleus

NLS-bearing protein import into nucleus

cellular localization [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein import into nucleus

NLS-bearing protein import into nucleus

nuclear transport [inference]

nucleocytoplasmic transport [inference]

import into nucleus [inference]

protein import into nucleus

NLS-bearing protein import into nucleus

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

regulation of Wnt signaling pathway [inference]

regulation of canonical Wnt signaling pathway

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

regulation of Wnt signaling pathway [inference]

regulation of canonical Wnt signaling pathway

regulation of cellular process [inference]

signal transduction [inference]

postsynaptic signal transduction [inference]

postsynapse to nucleus signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of Wnt signaling pathway [inference]

regulation of canonical Wnt signaling pathway

regulation of programmed cell death [inference]

regulation of apoptotic process

Displaying entries **1 - 5** of 19 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
nucleus	ISS	GO_REF
nucleus	ISO	GO_REF GO_REF
nucleus	IEA	GO_REF
nucleoplasm	ISO	GO_REF
nucleoplasm	NAS	PMID

GO Hierarchy

cellular component

protein-containing complex [inference]

nucleocytoplasmic transport complex [inference]

NLS-dependent protein nuclear import complex

cellular anatomical structure [inference]

cell junction [inference]

synapse [inference]

glutamatergic synapse

cell projection [inference]

plasma membrane bounded cell projection [inference]

neuron projection [inference]

dendrite

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

postsynaptic specialization [inference]

postsynaptic density

Displaying **all 3** entries
GO Term	Evidence Code	Reference
obsolete nuclear localization sequence binding
nuclear import signal receptor activity	ISO	GO_REF
nuclear import signal receptor activity	IEA	GO_REF GO_REF

GO Hierarchy

molecular function

molecular carrier activity [inference]

nucleocytoplasmic carrier activity [inference]

nuclear import signal receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MSTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQINNMEMAPGGVITSDMTDMIFSNSPEQQLSATQKFRKLLSKEPNPPIDEVINTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRNVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLNCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANMFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDAKIVQVALNGLENILRLGEQEAKRNGSGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLSQQQYIFQQCEAPMEGFQL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
406			G02815KT	GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 3** entries
Pathway Name	Organism
Apoptosis induced DNA fragmentation	Mus musculus
Assembly of the ORC complex at the origin of replication	Mus musculus
Interferon alpha/beta signaling	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements