GlyCosmos Portal

Submissions

Forkhead box protein G1

Summary

UniProt ID: Q60987
Gene Symbol: Fkhl1 Foxg1 Foxg1b Hfhbf1
Gene ID: 15228
Organism: Mus musculus (house mouse)

External Links

PubChem: Q60987
The O-GlcNAc Database: Q60987
Re-Glyco: Q60987

Annotation

Keyword: DNA-binding Developmental protein Nucleus Reference proteome Transcription regulation

Gene Ontology (GO)

Displaying entries **1 - 5** of 25 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
negative regulation of transcription by RNA polymerase II	IDA	PMID
positive regulation of neuroblast proliferation	IMP	PMID
regulation of transcription by RNA polymerase II	IBA	GO_REF
regulation of mitotic cell cycle	IMP	PMID
dorsal/ventral pattern formation	IMP	PMID PMID

GO Hierarchy

biological process

cellular process [inference]

cell recognition [inference]

neuron recognition [inference]

axon choice point recognition [inference]

axon midline choice point recognition

cellular developmental process [inference]

cell fate determination [inference]

neuron fate determination

cell differentiation [inference]

neurogenesis

cell development [inference]

neuron development [inference]

central nervous system neuron development

cell motility [inference]

cell migration [inference]

neuron migration [inference]

radial glia-guided pyramidal neuron migration [inference]

pyramidal neuron migration to cerebral cortex

glial cell migration [inference]

telencephalon glial cell migration [inference]

cerebral cortex radial glia-guided migration [inference]

pyramidal neuron migration to cerebral cortex

forebrain cell migration [inference]

telencephalon cell migration [inference]

cerebral cortex cell migration [inference]

cerebral cortex radially oriented cell migration [inference]

cerebral cortex radial glia-guided migration [inference]

pyramidal neuron migration to cerebral cortex

telencephalon glial cell migration [inference]

cerebral cortex radial glia-guided migration [inference]

pyramidal neuron migration to cerebral cortex

multicellular organismal process [inference]

pattern specification process [inference]

regionalization [inference]

dorsal/ventral pattern formation

developmental process [inference]

anatomical structure morphogenesis [inference]

cell morphogenesis [inference]

cell morphogenesis involved in neuron differentiation

embryonic morphogenesis [inference]

inner ear morphogenesis

anatomical structure development [inference]

cell development [inference]

neuron development [inference]

central nervous system neuron development

cellular developmental process [inference]

cell fate determination [inference]

neuron fate determination

cell differentiation [inference]

neurogenesis

cell development [inference]

neuron development [inference]

central nervous system neuron development

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of cell population proliferation [inference]

positive regulation of neural precursor cell proliferation [inference]

positive regulation of neuroblast proliferation

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of neuroblast proliferation

positive regulation of neuron differentiation

positive regulation of cell cycle

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of neuroblast proliferation

positive regulation of neuron differentiation

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of neuroblast proliferation

positive regulation of multicellular organismal process [inference]

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of neuroblast proliferation

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of cell differentiation [inference]

negative regulation of neuron differentiation

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of neuron differentiation

regulation of developmental process [inference]

regulation of cell differentiation [inference]

negative regulation of cell differentiation [inference]

negative regulation of neuron differentiation

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of neuroblast proliferation

positive regulation of neuron differentiation

regulation of neuron differentiation [inference]

regulation of cell development [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of neuroblast proliferation

regulation of neurogenesis [inference]

positive regulation of neurogenesis [inference]

positive regulation of neuroblast proliferation

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of neuron differentiation

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of neuroblast proliferation

positive regulation of neuron differentiation

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of neuroblast proliferation

regulation of multicellular organismal development [inference]

regulation of nervous system development [inference]

regulation of neurogenesis [inference]

positive regulation of neurogenesis [inference]

positive regulation of neuroblast proliferation

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of neuroblast proliferation

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation [inference]

positive regulation of neural precursor cell proliferation [inference]

positive regulation of neuroblast proliferation

regulation of neural precursor cell proliferation

regulation of neuroblast proliferation [inference]

positive regulation of neuroblast proliferation

positive regulation of neural precursor cell proliferation [inference]

positive regulation of neuroblast proliferation

regulation of cell differentiation [inference]

negative regulation of cell differentiation [inference]

negative regulation of neuron differentiation

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of neuroblast proliferation

positive regulation of neuron differentiation

regulation of neuron differentiation [inference]

regulation of cell development [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of neuroblast proliferation

regulation of neurogenesis [inference]

positive regulation of neurogenesis [inference]

positive regulation of neuroblast proliferation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation [inference]

positive regulation of neural precursor cell proliferation [inference]

positive regulation of neuroblast proliferation

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of neuroblast proliferation

positive regulation of neuron differentiation

positive regulation of cell cycle

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of cell differentiation [inference]

negative regulation of neuron differentiation

regulation of cell cycle

regulation of multicellular organismal process [inference]

positive regulation of multicellular organismal process [inference]

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of neuroblast proliferation

regulation of multicellular organismal development [inference]

regulation of nervous system development [inference]

regulation of neurogenesis [inference]

positive regulation of neurogenesis [inference]

positive regulation of neuroblast proliferation

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of neuroblast proliferation

Displaying **all 5** entries
GO Term	Evidence Code	Reference
nucleus	ISS	GO_REF
nucleus	IDA	PMID PMID
nucleus	IBA	GO_REF
nucleus	IEA	GO_REF
nucleoplasm	TAS	Reactome

GO Hierarchy

cellular component

cellular anatomical structure [inference]

nucleoplasm

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
DNA-binding transcription repressor activity, RNA polymerase II-specific	IC	GO_REF
sequence-specific DNA binding	IDA	PMID
sequence-specific DNA binding	IEA	GO_REF
sequence-specific double-stranded DNA binding	ISO	GO_REF
sequence-specific double-stranded DNA binding	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

nucleic acid binding [inference]

DNA binding [inference]

double-stranded DNA binding [inference]

sequence-specific double-stranded DNA binding

sequence-specific DNA binding

sequence-specific double-stranded DNA binding

transcription regulator activity [inference]

DNA-binding transcription factor activity [inference]

DNA-binding transcription factor activity, RNA polymerase II-specific [inference]

DNA-binding transcription repressor activity, RNA polymerase II-specific

DNA-binding transcription repressor activity [inference]

DNA-binding transcription repressor activity, RNA polymerase II-specific

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MLDMGDRKEVKMIPKSSFSINSLVPEAVQNDNHHASHGHHNSHHPQHHHHHHHHHHPPPPAPQPPPPPPQQQQQQPPPAPQPPQARGAPAADDDKGPQPLLLPPSTALDGAKADALGAKGEPGGGPAELAPVGPDEKEKGAGAGGEEKKGAGEGGKDGEGGKEGDKKNGKYEKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTTSRAKLAFKRGARLTSTGLTFMDRAGSLYWPMSPFLSLHHPRASSTLSYNGTTSAYPSHPMPYSSVLTQNSLGNNHSFSTANGLSVDRLVNGEIPYATHHLTAAALAASVPCGLSVPCSGTYSLNPCSVNLLAGQTSYFFPHVPHPSMTSQTSTSMSARAASSSTSPQAPSTLPCESLRPSLPSFTTGLSGGLSDYFTHQNQGSSSNPLIH

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites