GlyCosmos Portal

Submissions

Complement factor I

Summary

UniProt ID: Q61129
Gene Symbol: Cfi If
Gene ID: 12630
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0005454
GlyGen: Q61129
PubChem: Q61129
Re-Glyco: Q61129

Annotation

Keyword: Calcium Cleavage on pair of basic residues Complement pathway Disulfide bond Glycoprotein Metal-binding Reference proteome Repeat Secreted Serine protease Signal

Gene Ontology (GO)

Displaying **all 5** entries
GO Term	Evidence Code	Reference
proteolysis	ISO	GO_REF
proteolysis	IEA	GO_REF
complement activation	IMP	PMID
complement activation, classical pathway
innate immune response

GO Hierarchy

biological process

immune system process [inference]

immune effector process [inference]

complement activation

complement activation, classical pathway

activation of immune response [inference]

complement activation

complement activation, classical pathway

immune response [inference]

humoral immune response [inference]

complement activation

complement activation, classical pathway

innate immune response

cellular process [inference]

metabolic process [inference]

macromolecule metabolic process [inference]

protein metabolic process [inference]

proteolysis

primary metabolic process [inference]

protein metabolic process [inference]

proteolysis

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

immune response [inference]

humoral immune response [inference]

complement activation

complement activation, classical pathway

innate immune response

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

complement activation

complement activation, classical pathway

regulation of immune response [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

complement activation

complement activation, classical pathway

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

complement activation

complement activation, classical pathway

positive regulation of response to stimulus [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

complement activation

complement activation, classical pathway

regulation of response to stimulus [inference]

positive regulation of response to stimulus [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

complement activation

complement activation, classical pathway

regulation of immune response [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

complement activation

complement activation, classical pathway

Displaying **all 2** entries
GO Term	Evidence Code	Reference
obsolete extracellular space
membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane

Displaying **all 3** entries
GO Term	Evidence Code	Reference
serine-type endopeptidase activity	IEA	GO_REF GO_REF
serine-type peptidase activity	IBA	GO_REF
metal ion binding

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

peptidase activity [inference]

endopeptidase activity [inference]

serine-type endopeptidase activity

serine-type peptidase activity

serine-type endopeptidase activity

serine hydrolase activity [inference]

serine-type peptidase activity

serine-type endopeptidase activity

catalytic activity, acting on a protein [inference]

peptidase activity [inference]

endopeptidase activity [inference]

serine-type endopeptidase activity

serine-type peptidase activity

serine-type endopeptidase activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MKLAHLSLFLLALHLSSSRSPSASDLPQEELVDQKCLLQKYTHRSCNKVFCQPWQRCIEGTCICKLPYQCPRAGTPVCAMNGRSYPTYCHQKSFECLHPEIKFSHNGTCAAEGKFNVSLIYGRTKTEGLVQVKLVDQDERMFICKNSWSMAEANVACVDLGFPLGVRDIQGSFNISGNLHINDTECLHVHCRGVETSLAECAFTKRRTELSNGLAGVVCYKQDADFPTSLSFQCVNGKHIPQEKACNGVNDCGDQSDELCCKGCRGNASLCKSGVCIPDQYKCNGEVDCITGEDESRCEEDRQQNIPKGLARSAQGEAEIETEETEMLTPGMDNERKRIKSLLPKLSCGVKRNTHTRRKRVIGGKPANVGDYPWQVAIKDGQRITCGGIYIGGCWILTAAHCVRPSRAHSYQVWTALLDWLKPNSQLGIQTVKRVIVHEKYNGATFQNDIALIEMKMHTGKKECELPNSVPACVPWSPYLFQPNDRCIISGWGRGKDNQKVYSLRWGEVDLIGNCSQFYPDRYYEKEMQCAGTRDGSIDACKGDSGGPLVCEDINNVTYVWGIVSWGENCGKPEFPGVYTRVANYFDWISYHVGRSLVSQHNV

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 7** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
106	N-linked (GlcNAc...) asparagine		G85269DF	GlycoProtDB UniProt GlyGen
116	N-linked (GlcNAc...) asparagine	16944957	G10486CT	GlycoProtDB UniProt GlyGen
174	N-linked (GlcNAc...) asparagine			UniProt GlyGen
182	N-linked (GlcNAc...) asparagine			UniProt GlyGen
267	N-linked (GlcNAc...) asparagine			GlycoProtDB UniProt GlyGen
514	N-linked (GlcNAc...) asparagine	17330941		GlycoProtDB UniProt GlyGen
556	N-linked (GlcNAc...) asparagine			UniProt GlyGen