GlyCosmos Portal

GlyTouCan

Glycan Structure Repository

GlyComb

Glycoconjugate Repository

GlycoPOST

Glycomics MS raw data Repository

UniCarb-DR

Glycomics MS Repository for glycan annotations from GlycoWorkbench

LM-GlycoRepo

Repository for lectin-assisted multimodality data

All Resources

Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms

Other Information

Release Statistics Download

Tools

Glycan Converters

LM-GlycomeAtlas

Search Tools

Cross Search Glycan Search Publication Search Programmatic Access

Guidelines

MIRAGE

Leukocyte surface antigen CD53

Summary

UniProt ID: Q61451
Gene Symbol: Cd53
Gene ID: 12508
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0005483
Re-Glyco: Q61451

Annotation

Keyword: Cell junction Cell membrane Glycoprotein Reference proteome Transmembrane helix

Gene Ontology (GO)

Displaying **all 4** entries
GO Term	Evidence Code	Reference
receptor clustering	ISO	GO_REF
receptor clustering	IEA	GO_REF
T cell receptor signaling pathway	ISO	GO_REF
positive regulation of myoblast fusion	IDA	PMID

GO Hierarchy

biological process

immune system process [inference]

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

cellular process [inference]

signal transduction [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

cell surface receptor signaling pathway [inference]

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

cellular localization [inference]

localization within membrane [inference]

protein localization to membrane [inference]

receptor clustering

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein localization to membrane [inference]

receptor clustering

cellular localization [inference]

localization within membrane [inference]

protein localization to membrane [inference]

receptor clustering

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

regulation of immune response [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

positive regulation of cellular process [inference]

positive regulation of cellular component organization [inference]

positive regulation of syncytium formation by plasma membrane fusion [inference]

positive regulation of myoblast fusion

positive regulation of response to stimulus [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

regulation of response to stimulus [inference]

positive regulation of response to stimulus [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

regulation of immune response [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

regulation of cellular process [inference]

signal transduction [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

cell surface receptor signaling pathway [inference]

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

positive regulation of cellular process [inference]

positive regulation of cellular component organization [inference]

positive regulation of syncytium formation by plasma membrane fusion [inference]

positive regulation of myoblast fusion

regulation of cellular component organization [inference]

positive regulation of cellular component organization [inference]

positive regulation of syncytium formation by plasma membrane fusion [inference]

positive regulation of myoblast fusion

regulation of syncytium formation by plasma membrane fusion [inference]

positive regulation of syncytium formation by plasma membrane fusion [inference]

positive regulation of myoblast fusion

regulation of myoblast fusion [inference]

positive regulation of myoblast fusion

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
immunological synapse	ISO	GO_REF
immunological synapse	IEA	GO_REF
plasma membrane	ISO	GO_REF
plasma membrane	EXP	PMID PMID
plasma membrane	IDA	PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

cell junction [inference]

anchoring junction [inference]

cell-cell junction

Displaying **all 4** entries
GO Term	Evidence Code	Reference
identical protein binding	ISO	GO_REF
identical protein binding	IEA	GO_REF
protein-membrane adaptor activity	ISO	GO_REF
protein-membrane adaptor activity	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

identical protein binding

molecular adaptor activity [inference]

protein-macromolecule adaptor activity [inference]

protein-membrane adaptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MGMSSLKLLKYVLFIFNLLFWVCGCCILGFGIYFLVQNTYGVLFRNLPFLTLGNILVIVGSIIMVVAFLGCMGSIKENKCLLMSFFVLLLIILLAEVTIAILLFVYEQKLNTLVAEGLNDSIQHYHSDNSTMKAWDFIQTQLQCCGVNGSSDWTSGPPSSCPSGADVQGCYNKAKSWFHSNFLYIGIITICVCVIQVLGMSFALTLNCQIDKTSQALGL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
119	N-linked (GlcNAc...) asparagine			UniProt
129	N-linked (GlcNAc...) asparagine			GlycoProtDB UniProt
148	N-linked (GlcNAc...) asparagine			GlycoProtDB UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Neutrophil degranulation	Mus musculus

About Release Notes Help Feedback

Click here to visit the beta site.

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026