GlyCosmos Portal

Submissions

StAR-related lipid transfer protein 3

Summary

UniProt ID: Q61542
Gene Symbol: Stard3 Es64 Mln64
Gene ID: 59045
Organism: Mus musculus (house mouse)

External Links

PubChem: Q61542
The O-GlcNAc Database: Q61542
Re-Glyco: Q61542

Annotation

Keyword: Endosome Lipid transport Lipid-binding Phosphoprotein Reference proteome Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
progesterone biosynthetic process	IMP	PMID
cholesterol transport	ISS	GO_REF
cholesterol transport	ISO	GO_REF
cholesterol transport	IBA	GO_REF
cholesterol transport	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

biosynthetic process [inference]

lipid biosynthetic process [inference]

steroid biosynthetic process [inference]

steroid hormone biosynthetic process [inference]

C21-steroid hormone biosynthetic process [inference]

progesterone biosynthetic process

hormone biosynthetic process [inference]

C21-steroid hormone biosynthetic process [inference]

progesterone biosynthetic process

small molecule biosynthetic process [inference]

ketone biosynthetic process [inference]

progesterone biosynthetic process

olefinic compound biosynthetic process [inference]

progesterone biosynthetic process

ketone metabolic process [inference]

ketone biosynthetic process [inference]

progesterone biosynthetic process

progesterone metabolic process [inference]

progesterone biosynthetic process

hormone metabolic process [inference]

C21-steroid hormone metabolic process [inference]

C21-steroid hormone biosynthetic process [inference]

progesterone biosynthetic process

progesterone metabolic process [inference]

progesterone biosynthetic process

hormone biosynthetic process [inference]

C21-steroid hormone biosynthetic process [inference]

progesterone biosynthetic process

primary metabolic process [inference]

lipid metabolic process [inference]

steroid metabolic process [inference]

steroid biosynthetic process [inference]

steroid hormone biosynthetic process [inference]

C21-steroid hormone biosynthetic process [inference]

progesterone biosynthetic process

C21-steroid hormone metabolic process [inference]

C21-steroid hormone biosynthetic process [inference]

progesterone biosynthetic process

progesterone metabolic process [inference]

progesterone biosynthetic process

lipid biosynthetic process [inference]

steroid biosynthetic process [inference]

steroid hormone biosynthetic process [inference]

C21-steroid hormone biosynthetic process [inference]

progesterone biosynthetic process

small molecule metabolic process [inference]

small molecule biosynthetic process [inference]

ketone biosynthetic process [inference]

progesterone biosynthetic process

olefinic compound metabolic process [inference]

progesterone metabolic process [inference]

progesterone biosynthetic process

olefinic compound biosynthetic process [inference]

progesterone biosynthetic process

cellular component organization or biogenesis [inference]

cellular component organization [inference]

vesicle tethering [inference]

vesicle tethering to endoplasmic reticulum

localization [inference]

establishment of localization [inference]

transport [inference]

lipid transport [inference]

sterol transport [inference]

cholesterol transport

organic hydroxy compound transport [inference]

sterol transport [inference]

cholesterol transport

biological regulation [inference]

regulation of biological quality [inference]

regulation of hormone levels [inference]

hormone metabolic process [inference]

C21-steroid hormone metabolic process [inference]

C21-steroid hormone biosynthetic process [inference]

progesterone biosynthetic process

progesterone metabolic process [inference]

progesterone biosynthetic process

hormone biosynthetic process [inference]

C21-steroid hormone biosynthetic process [inference]

progesterone biosynthetic process

Displaying entries **1 - 5** of 23 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
nucleoplasm	ISO	GO_REF
cytoplasm	ISS	PMID
mitochondrion	IDA	PMID
endosome	ISO	GO_REF
endosome	IDA	PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

endoplasmic reticulum membrane

vesicle membrane [inference]

cytoplasmic vesicle membrane [inference]

endosome membrane [inference]

late endosome membrane

bounding membrane of organelle [inference]

endosome membrane [inference]

late endosome membrane

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

late endosome

intracellular membrane-bounded organelle [inference]

mitochondrion

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

late endosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

late endosome

organelle membrane contact site

endoplasmic reticulum-endosome membrane contact site

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
cholesterol binding	ISO	GO_REF
cholesterol binding	IBA	GO_REF
cholesterol binding	IEA	GO_REF GO_REF
protein homodimerization activity	ISS	GO_REF
protein homodimerization activity	ISO	GO_REF

GO Hierarchy

molecular function

transporter activity [inference]

lipid transfer activity [inference]

sterol transfer activity [inference]

cholesterol transfer activity

binding [inference]

protein binding [inference]

identical protein binding [inference]

protein homodimerization activity

protein dimerization activity [inference]

protein homodimerization activity

lipid binding [inference]

steroid binding [inference]

sterol binding [inference]

cholesterol binding

small molecule binding [inference]

alcohol binding [inference]

cholesterol binding

molecular carrier activity [inference]

lipid carrier activity [inference]

lipid transfer activity [inference]

sterol transfer activity [inference]

cholesterol transfer activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MSKRPGDLACDLERSLPALASLGTSLSHSQSLSSHFIPPPLEKRRAISDVRRTFCLFVTFDLLFISLLWIIELNTNTGIRKNLEQEVIHYSFQSSFFDIFVLAFFRFSGLLLGYAVLRLQHWWVIAVTTLVSSAFLIVKVILSELLSKGAFGYLLPIVSFVLAWLETWFLDFKVLPQEAEEERWYLAAQAAVARGPLLFSGALSEGQFYSPPESFAGSDNESDEEVTGKKSFSAQEREYIRQGKEATAVVDQILAQEENWKFERSNEYGDTVYTIEVPFHGKTFILKTFLPCPAELVYQEVILQPERMVLWNKTVTACQILQRVEDNTLVSYDVSSGAAGGVVSPRDFVNVRRIERRRDRYLSSGIATTHCSKPPTHKYVRGENGPGGFIVLKSANNPRVCTFVWILNTDLKGRLPRYLIHQSLGATMFEFAFHLRQRVGELGARA

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites