GlyCosmos Portal

Submissions

Haptoglobin [Cleaved into: Haptoglobin alpha chain; Haptoglobin beta chain]

Summary

UniProt ID: Q61646
Gene Symbol: Hp
Gene ID: 15439
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB

GPDB0005514

GlyConnect

Haptoglobin

GlyGen

Q61646

PubChem

Q61646

Re-Glyco

Q61646

Annotation

Keyword: Acute phase Antibiotic Antioxidant Disulfide bond Glycoprotein Hemoglobin-binding Immunity Reference proteome Secreted Serine protease homolog Signal Sushi

Gene Ontology (GO)

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
liver development	ISO	GO_REF
immune system process
acute-phase response
Notch signaling pathway	IDA	PMID
response to bacterium	IEP	PMID

GO Hierarchy

biological process

immune system process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

Notch signaling pathway

metabolic process [inference]

macromolecule metabolic process [inference]

protein metabolic process [inference]

proteolysis [inference]

protein processing [inference]

zymogen activation

protein maturation [inference]

protein processing [inference]

zymogen activation

primary metabolic process [inference]

protein metabolic process [inference]

proteolysis [inference]

protein processing [inference]

zymogen activation

protein maturation [inference]

protein processing [inference]

zymogen activation

developmental process [inference]

anatomical structure development [inference]

animal gross anatomical part developmental process [inference]

animal organ development [inference]

gland development [inference]

liver development

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

response to bacterium

defense response to bacterium

response to stimulus [inference]

response to stress [inference]

defense response [inference]

inflammatory response [inference]

acute inflammatory response [inference]

acute-phase response

defense response to bacterium

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to bacterium

defense response to bacterium

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to bacterium

defense response to bacterium

biological regulation [inference]

regulation of biological process [inference]

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

Notch signaling pathway

Displaying **all 5** entries
GO Term	Evidence Code	Reference
obsolete extracellular space
haptoglobin-hemoglobin complex	ISO	GO_REF
spherical high-density lipoprotein particle	ISO	GO_REF
blood microparticle	ISO	GO_REF
blood microparticle	IBA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

haptoglobin-hemoglobin complex

protein-lipid complex [inference]

lipoprotein particle [inference]

plasma lipoprotein particle [inference]

high-density lipoprotein particle [inference]

spherical high-density lipoprotein particle

extracellular protein-containing complex [inference]

plasma lipoprotein particle [inference]

high-density lipoprotein particle [inference]

spherical high-density lipoprotein particle

cellular anatomical structure [inference]

blood microparticle

Displaying **all 5** entries
GO Term	Evidence Code	Reference
serine-type endopeptidase activity	IBA	GO_REF
antioxidant activity
hemoglobin binding	ISO	GO_REF GO_REF
hemoglobin binding	IEA	GO_REF
identical protein binding	ISO	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

peptidase activity [inference]

endopeptidase activity [inference]

serine-type endopeptidase activity

serine-type peptidase activity [inference]

serine-type endopeptidase activity

serine hydrolase activity [inference]

serine-type peptidase activity [inference]

serine-type endopeptidase activity

catalytic activity, acting on a protein [inference]

peptidase activity [inference]

endopeptidase activity [inference]

serine-type endopeptidase activity

serine-type peptidase activity [inference]

serine-type endopeptidase activity

binding [inference]

protein binding [inference]

antioxidant activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MRALGAVVTLLLWGQLFAVELGNDAMDFEDDSCPKPPEIANGYVEHLVRYRCRQFYRLRAEGDGVYTLNDEKQWVNTVAGEKLPECEAVCGKPKHPVDQVQRIIGGSMDAKGSFPWQAKMISRHGLTTGATLISDQWLLTTAKNLFLNHSETASAKDITPTLTLYVGKNQLVEIEKVVLHPNHSVVDIGLIKLKQRVLVTERVMPICLPSKDYIAPGRVGYVSGWGRNANFRFTDRLKYVMLPVADQDKCVVHYENSTVPEKKNLTSPVGVQPILNEHTFCAGLTKYQEDTCYGDAGSAFAIHDMEEDTWYAAGILSFDKSCAVAEYGVYVRATDLKDWVQETMAKN

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
148	N-linked (GlcNAc...) asparagine	16944957 20571061	G15569GG G40608DF G83460ZZ	GlycoProtDB UniProt GlyGen GlyConnect
182	N-linked (GlcNAc...) asparagine	16944957	G80920RR	GlycoProtDB UniProt GlyGen
256	N-linked (GlcNAc...) asparagine	16944957 20571061	G15569GG G24748EV G40608DF	GlycoProtDB UniProt GlyGen GlyConnect
264	N-linked (GlcNAc...) asparagine		G60033FS	GlycoProtDB UniProt GlyGen