GlyCosmos Portal

Submissions

Bone marrow proteoglycan

Summary

UniProt ID: Q61878
Gene Symbol: Mbp-1 Prg2
Gene ID: 19074
Organism: Mus musculus (house mouse)

External Links

RaftProt: Q61878
Re-Glyco: Q61878

Annotation

Keyword: Antibiotic Direct protein sequencing Disulfide bond Immunity Lectin Nitration Proteoglycan Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying **all 5** entries
GO Term	Evidence Code	Reference
defense response to nematode	IMP	PMID
immune response	IEA	GO_REF
negative regulation of interleukin-10 production	IMP	PMID
positive regulation of interleukin-4 production	IMP	PMID
defense response to bacterium

GO Hierarchy

biological process

immune system process [inference]

immune response

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

defense response to nematode

response to bacterium [inference]

defense response to bacterium

response to stimulus [inference]

response to stress [inference]

defense response [inference]

immune response

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to nematode

response to bacterium [inference]

defense response to bacterium

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to nematode

response to bacterium [inference]

defense response to bacterium

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-4 production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-4 production

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-4 production

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-10 production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-10 production

negative regulation of multicellular organismal process [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-10 production

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-10 production

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-4 production

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-10 production

positive regulation of cytokine production [inference]

positive regulation of interleukin-4 production

regulation of interleukin-10 production [inference]

negative regulation of interleukin-10 production

regulation of interleukin-4 production [inference]

positive regulation of interleukin-4 production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-4 production

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-10 production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-4 production

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-10 production

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-10 production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-10 production

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-4 production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-4 production

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-10 production

positive regulation of cytokine production [inference]

positive regulation of interleukin-4 production

regulation of interleukin-10 production [inference]

negative regulation of interleukin-10 production

regulation of interleukin-4 production [inference]

positive regulation of interleukin-4 production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-4 production

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-10 production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-4 production

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-10 production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-4 production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-10 production

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-4 production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-4 production

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-10 production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-10 production

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-10 production

positive regulation of cytokine production [inference]

positive regulation of interleukin-4 production

regulation of interleukin-10 production [inference]

negative regulation of interleukin-10 production

regulation of interleukin-4 production [inference]

positive regulation of interleukin-4 production

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-4 production

negative regulation of multicellular organismal process [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-10 production

Displaying **all 4** entries
GO Term	Evidence Code	Reference
extracellular region	ISS	GO_REF
extracellular region	ISO	GO_REF
extracellular region	IEA	GO_REF
extracellular matrix	HDA	PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

extracellular region

external encapsulating structure [inference]

extracellular matrix

Displaying 1 entry
GO Term	Evidence Code	Reference
carbohydrate binding

GO Hierarchy

molecular function

binding [inference]

carbohydrate binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MKFPLLLALLVGGASALHLSSETSDSKSPLMDENLPRDAEISGPEGEECPPGEELMPLEGEKEEGSGSEGVPGDEGAVSGQDVTDVDLQCPKEEDTTSLMGDSGCKTCRYLLVRRAECFDKAQSVCRRCYRGTLASIHSFSVNFGIQSAVRGINQGQVWIGGRIKGWGRCKRFRWVDGSSWNFAYWAAGQPCPGGGRCVTLCTQGGHWRLSHCVKRRPFICSY

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites