GlyCosmos Portal

Submissions

Nucleophosmin

Summary

UniProt ID: Q61937
Gene Symbol: Npm1
Gene ID: 18148
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q61937
PubChem: Q61937
The O-GlcNAc Database: Q61937
RaftProt: Q61937
O-GlcNAcAtlas: Q61937
Re-Glyco: Q61937

Annotation

Keyword: 3D-structure ADP-ribosylation Acetylation Chaperone Cytoskeleton DNA-binding Direct protein sequencing Disulfide bond Isopeptide bond Nucleus Phosphoprotein RNA-binding Reference proteome Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 99 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
ribosomal large subunit export from nucleus	IMP	PMID
ribosomal large subunit export from nucleus	IBA	GO_REF
ribosomal small subunit export from nucleus	IDA	PMID
ribosomal small subunit export from nucleus	IBA	GO_REF
cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

microtubule-based process [inference]

microtubule organizing center organization [inference]

centrosome cycle

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

rRNA transcription

nucleobase-containing compound biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

rRNA transcription

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

rRNA transcription

nucleic acid metabolic process [inference]

DNA metabolic process [inference]

DNA repair

RNA metabolic process [inference]

rRNA metabolic process [inference]

rRNA processing [inference]

endonucleolytic cleavage of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [inference]

cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)

rRNA transcription

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

rRNA transcription

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

rRNA transcription

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

rRNA transcription

nucleic acid metabolic process [inference]

DNA metabolic process [inference]

DNA repair

RNA metabolic process [inference]

rRNA metabolic process [inference]

rRNA processing [inference]

endonucleolytic cleavage of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [inference]

cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)

rRNA transcription

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

rRNA transcription

nucleic acid biosynthetic process [inference]

RNA biosynthetic process [inference]

DNA-templated transcription [inference]

rRNA transcription

RNA processing [inference]

rRNA processing [inference]

endonucleolytic cleavage of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [inference]

cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)

intercellular transport [inference]

nuclear export [inference]

ribosomal subunit export from nucleus [inference]

import into nucleus [inference]

protein import into nucleus

cell cycle process [inference]

centrosome cycle

cellular developmental process [inference]

cell differentiation [inference]

leukocyte differentiation [inference]

myeloid leukocyte differentiation [inference]

macrophage differentiation

mononuclear cell differentiation [inference]

macrophage differentiation

myeloid cell differentiation [inference]

myeloid leukocyte differentiation [inference]

macrophage differentiation

cellular localization [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein import into nucleus

nuclear transport [inference]

nucleocytoplasmic transport

nuclear export [inference]

ribosomal subunit export from nucleus [inference]

import into nucleus [inference]

protein import into nucleus

cellular response to stimulus [inference]

cellular response to stress [inference]

DNA damage response [inference]

DNA repair

cellular response to environmental stimulus [inference]

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to light stimulus [inference]

cellular response to UV

cellular component organization or biogenesis [inference]

cellular component organization [inference]

chromatin organization [inference]

chromatin remodeling

nucleosome organization [inference]

nucleosome assembly

cellular component assembly [inference]

protein-containing complex assembly [inference]

protein-DNA complex assembly [inference]

nucleosome assembly

microtubule organizing center organization [inference]

centrosome cycle

regulation of cellular component size [inference]

regulation of cell size [inference]

cell volume homeostasis

protein-containing complex organization [inference]

protein-containing complex assembly [inference]

protein-DNA complex assembly [inference]

nucleosome assembly

protein-DNA complex organization [inference]

nucleosome organization [inference]

nucleosome assembly

protein-DNA complex assembly [inference]

nucleosome assembly

cellular component biogenesis [inference]

ribonucleoprotein complex biogenesis [inference]

cellular senescence

developmental process [inference]

cellular developmental process [inference]

cell differentiation [inference]

leukocyte differentiation [inference]

myeloid leukocyte differentiation [inference]

macrophage differentiation

mononuclear cell differentiation [inference]

macrophage differentiation

myeloid cell differentiation [inference]

myeloid leukocyte differentiation [inference]

macrophage differentiation

homeostatic process [inference]

cellular homeostasis [inference]

cell volume homeostasis

response to stimulus [inference]

response to stress [inference]

cellular response to stress [inference]

DNA damage response [inference]

DNA repair

response to abiotic stimulus [inference]

response to radiation [inference]

response to light stimulus [inference]

response to UV [inference]

cellular response to UV

cellular response to light stimulus [inference]

cellular response to UV

cellular response to radiation [inference]

cellular response to light stimulus [inference]

cellular response to UV

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to light stimulus [inference]

cellular response to UV

cellular response to stimulus [inference]

cellular response to stress [inference]

DNA damage response [inference]

DNA repair

cellular response to environmental stimulus [inference]

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to light stimulus [inference]

cellular response to UV

localization [inference]

macromolecule localization [inference]

intracellular protein localization

protein transport [inference]

intracellular protein transport [inference]

protein import into nucleus

protein localization to organelle [inference]

protein localization to nucleus [inference]

protein import into nucleus

establishment of localization [inference]

transport [inference]

intercellular transport [inference]

nuclear export [inference]

ribosomal subunit export from nucleus [inference]

import into nucleus [inference]

protein import into nucleus

protein transport [inference]

intracellular protein transport [inference]

protein import into nucleus

intracellular transport [inference]

intracellular protein transport [inference]

protein import into nucleus

nuclear transport [inference]

nucleocytoplasmic transport

nuclear export [inference]

ribosomal subunit export from nucleus [inference]

import into nucleus [inference]

protein import into nucleus

establishment of protein localization [inference]

protein transport [inference]

intracellular protein transport [inference]

protein import into nucleus

establishment of protein localization to organelle [inference]

protein import into nucleus

establishment of localization in cell [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein import into nucleus

nuclear transport [inference]

nucleocytoplasmic transport

nuclear export [inference]

ribosomal subunit export from nucleus [inference]

import into nucleus [inference]

protein import into nucleus

establishment of organelle localization [inference]

ribosomal subunit export from nucleus [inference]

organelle localization [inference]

ribosome localization [inference]

ribosomal subunit export from nucleus [inference]

establishment of organelle localization [inference]

ribosomal subunit export from nucleus [inference]

cellular localization [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein import into nucleus

nuclear transport [inference]

nucleocytoplasmic transport

nuclear export [inference]

ribosomal subunit export from nucleus [inference]

import into nucleus [inference]

protein import into nucleus

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

regulation of intracellular signal transduction [inference]

regulation of signal transduction by p53 class mediator [inference]

regulation of DNA damage response, signal transduction by p53 class mediator

regulation of localization [inference]

regulation of protein localization [inference]

regulation of protein localization to nucleus [inference]

positive regulation of protein localization to nucleus [inference]

positive regulation of protein localization to nucleolus

regulation of protein localization to nucleolus [inference]

positive regulation of protein localization to nucleolus

positive regulation of protein localization [inference]

positive regulation of protein localization to nucleus [inference]

positive regulation of protein localization to nucleolus

regulation of growth [inference]

regulation of cell growth

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of translation

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of translation

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of DNA metabolic process

positive regulation of DNA replication

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

positive regulation of translation

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of cell cycle [inference]

positive regulation of cell cycle process [inference]

positive regulation of centrosome duplication

positive regulation of cell cycle phase transition [inference]

positive regulation of cell cycle G2/M phase transition

positive regulation of protein localization [inference]

positive regulation of protein localization to nucleus [inference]

positive regulation of protein localization to nucleolus

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of cell population proliferation

negative regulation of epithelial cell proliferation

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA splicing [inference]

negative regulation of mRNA splicing, via spliceosome

negative regulation of phosphorus metabolic process [inference]

negative regulation of phosphate metabolic process [inference]

negative regulation of phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity [inference]

negative regulation of protein kinase activity by regulation of protein phosphorylation

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity [inference]

negative regulation of protein kinase activity by regulation of protein phosphorylation

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA splicing [inference]

negative regulation of mRNA splicing, via spliceosome

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity [inference]

negative regulation of protein kinase activity by regulation of protein phosphorylation

negative regulation of RNA metabolic process [inference]

negative regulation of mRNA metabolic process [inference]

negative regulation of mRNA processing [inference]

negative regulation of mRNA splicing, via spliceosome

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of mRNA metabolic process [inference]

negative regulation of mRNA processing [inference]

negative regulation of mRNA splicing, via spliceosome

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of muscle cell apoptotic process [inference]

negative regulation of striated muscle cell apoptotic process [inference]

negative regulation of cardiac muscle cell apoptotic process

negative regulation of neuron apoptotic process

negative regulation of cell cycle [inference]

negative regulation of cell cycle process [inference]

negative regulation of centrosome cycle [inference]

negative regulation of centrosome duplication

negative regulation of cellular component organization [inference]

negative regulation of organelle organization [inference]

negative regulation of cytoskeleton organization [inference]

negative regulation of centrosome cycle [inference]

negative regulation of centrosome duplication

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

regulation of intracellular signal transduction [inference]

regulation of signal transduction by p53 class mediator [inference]

regulation of DNA damage response, signal transduction by p53 class mediator

regulation of response to stress [inference]

regulation of cellular response to stress [inference]

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of intracellular signal transduction [inference]

regulation of signal transduction by p53 class mediator [inference]

regulation of DNA damage response, signal transduction by p53 class mediator

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA splicing [inference]

negative regulation of mRNA splicing, via spliceosome

positive regulation of biosynthetic process

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of translation

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

posttranscriptional regulation of gene expression

regulation of translation [inference]

regulation of translational initiation [inference]

regulation of eIF2 alpha phosphorylation by dsRNA

positive regulation of translation

regulation of RNA stability [inference]

regulation of mRNA stability [inference]

regulation of mRNA stability involved in cellular response to UV

positive regulation of gene expression [inference]

positive regulation of translation

negative regulation of gene expression

negative regulation of RNA splicing [inference]

negative regulation of mRNA splicing, via spliceosome

regulation of RNA splicing [inference]

negative regulation of RNA splicing [inference]

negative regulation of mRNA splicing, via spliceosome

regulation of mRNA splicing, via spliceosome [inference]

negative regulation of mRNA splicing, via spliceosome

regulation of mRNA catabolic process [inference]

regulation of mRNA stability [inference]

regulation of mRNA stability involved in cellular response to UV

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of translation

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA splicing [inference]

negative regulation of mRNA splicing, via spliceosome

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA splicing [inference]

negative regulation of mRNA splicing, via spliceosome

negative regulation of phosphorus metabolic process [inference]

negative regulation of phosphate metabolic process [inference]

negative regulation of phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity [inference]

negative regulation of protein kinase activity by regulation of protein phosphorylation

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity [inference]

negative regulation of protein kinase activity by regulation of protein phosphorylation

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA splicing [inference]

negative regulation of mRNA splicing, via spliceosome

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity [inference]

negative regulation of protein kinase activity by regulation of protein phosphorylation

negative regulation of RNA metabolic process [inference]

negative regulation of mRNA metabolic process [inference]

negative regulation of mRNA processing [inference]

negative regulation of mRNA splicing, via spliceosome

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of mRNA metabolic process [inference]

negative regulation of mRNA processing [inference]

negative regulation of mRNA splicing, via spliceosome

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of translation

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of translation

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of DNA metabolic process

positive regulation of DNA replication

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

positive regulation of translation

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of catabolic process [inference]

regulation of RNA stability [inference]

regulation of mRNA stability [inference]

regulation of mRNA stability involved in cellular response to UV

regulation of mRNA catabolic process [inference]

regulation of mRNA stability [inference]

regulation of mRNA stability involved in cellular response to UV

regulation of phosphorus metabolic process [inference]

negative regulation of phosphorus metabolic process [inference]

negative regulation of phosphate metabolic process [inference]

negative regulation of phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity [inference]

negative regulation of protein kinase activity by regulation of protein phosphorylation

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity [inference]

negative regulation of protein kinase activity by regulation of protein phosphorylation

regulation of phosphorylation [inference]

regulation of protein phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity [inference]

negative regulation of protein kinase activity by regulation of protein phosphorylation

regulation of protein kinase activity [inference]

negative regulation of protein kinase activity [inference]

negative regulation of protein kinase activity by regulation of protein phosphorylation

regulation of eIF2 alpha phosphorylation by dsRNA

negative regulation of phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity [inference]

negative regulation of protein kinase activity by regulation of protein phosphorylation

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity [inference]

negative regulation of protein kinase activity by regulation of protein phosphorylation

regulation of kinase activity [inference]

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity [inference]

negative regulation of protein kinase activity by regulation of protein phosphorylation

regulation of protein kinase activity [inference]

negative regulation of protein kinase activity [inference]

negative regulation of protein kinase activity by regulation of protein phosphorylation

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

posttranscriptional regulation of gene expression

regulation of translation [inference]

regulation of translational initiation [inference]

regulation of eIF2 alpha phosphorylation by dsRNA

positive regulation of translation

regulation of RNA stability [inference]

regulation of mRNA stability [inference]

regulation of mRNA stability involved in cellular response to UV

positive regulation of gene expression [inference]

positive regulation of translation

negative regulation of gene expression

negative regulation of RNA splicing [inference]

negative regulation of mRNA splicing, via spliceosome

regulation of RNA splicing [inference]

negative regulation of RNA splicing [inference]

negative regulation of mRNA splicing, via spliceosome

regulation of mRNA splicing, via spliceosome [inference]

negative regulation of mRNA splicing, via spliceosome

regulation of mRNA catabolic process [inference]

regulation of mRNA stability [inference]

regulation of mRNA stability involved in cellular response to UV

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of translation

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA splicing [inference]

negative regulation of mRNA splicing, via spliceosome

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of translation

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of DNA metabolic process

positive regulation of DNA replication

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

positive regulation of translation

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA splicing [inference]

negative regulation of mRNA splicing, via spliceosome

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity [inference]

negative regulation of protein kinase activity by regulation of protein phosphorylation

negative regulation of RNA metabolic process [inference]

negative regulation of mRNA metabolic process [inference]

negative regulation of mRNA processing [inference]

negative regulation of mRNA splicing, via spliceosome

regulation of DNA metabolic process [inference]

regulation of DNA replication [inference]

positive regulation of DNA replication

positive regulation of DNA metabolic process

positive regulation of DNA replication

regulation of protein metabolic process [inference]

regulation of translation [inference]

regulation of translational initiation [inference]

regulation of eIF2 alpha phosphorylation by dsRNA

positive regulation of translation

regulation of protein modification process [inference]

regulation of protein phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity [inference]

negative regulation of protein kinase activity by regulation of protein phosphorylation

regulation of protein kinase activity [inference]

negative regulation of protein kinase activity [inference]

negative regulation of protein kinase activity by regulation of protein phosphorylation

regulation of eIF2 alpha phosphorylation by dsRNA

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity [inference]

negative regulation of protein kinase activity by regulation of protein phosphorylation

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

regulation of post-translational protein modification [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

regulation of protein modification by small protein conjugation or removal [inference]

regulation of protein ubiquitination [inference]

positive regulation of protein ubiquitination

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

positive regulation of translation

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity [inference]

negative regulation of protein kinase activity by regulation of protein phosphorylation

regulation of RNA metabolic process [inference]

regulation of RNA stability [inference]

regulation of mRNA stability [inference]

regulation of mRNA stability involved in cellular response to UV

negative regulation of RNA metabolic process [inference]

negative regulation of mRNA metabolic process [inference]

negative regulation of mRNA processing [inference]

negative regulation of mRNA splicing, via spliceosome

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of mRNA metabolic process [inference]

regulation of mRNA processing [inference]

regulation of mRNA splicing, via spliceosome [inference]

negative regulation of mRNA splicing, via spliceosome

negative regulation of mRNA processing [inference]

negative regulation of mRNA splicing, via spliceosome

regulation of mRNA catabolic process [inference]

regulation of mRNA stability [inference]

regulation of mRNA stability involved in cellular response to UV

negative regulation of mRNA metabolic process [inference]

negative regulation of mRNA processing [inference]

negative regulation of mRNA splicing, via spliceosome

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of mRNA metabolic process [inference]

negative regulation of mRNA processing [inference]

negative regulation of mRNA splicing, via spliceosome

regulation of DNA metabolic process [inference]

regulation of DNA replication [inference]

positive regulation of DNA replication

positive regulation of DNA metabolic process

positive regulation of DNA replication

regulation of RNA metabolic process [inference]

regulation of RNA stability [inference]

regulation of mRNA stability [inference]

regulation of mRNA stability involved in cellular response to UV

negative regulation of RNA metabolic process [inference]

negative regulation of mRNA metabolic process [inference]

negative regulation of mRNA processing [inference]

negative regulation of mRNA splicing, via spliceosome

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of mRNA metabolic process [inference]

regulation of mRNA processing [inference]

regulation of mRNA splicing, via spliceosome [inference]

negative regulation of mRNA splicing, via spliceosome

negative regulation of mRNA processing [inference]

negative regulation of mRNA splicing, via spliceosome

regulation of mRNA catabolic process [inference]

regulation of mRNA stability [inference]

regulation of mRNA stability involved in cellular response to UV

negative regulation of mRNA metabolic process [inference]

negative regulation of mRNA processing [inference]

negative regulation of mRNA splicing, via spliceosome

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of RNA splicing [inference]

negative regulation of RNA splicing [inference]

negative regulation of mRNA splicing, via spliceosome

regulation of mRNA splicing, via spliceosome [inference]

negative regulation of mRNA splicing, via spliceosome

regulation of protein metabolic process [inference]

regulation of translation [inference]

regulation of translational initiation [inference]

regulation of eIF2 alpha phosphorylation by dsRNA

positive regulation of translation

regulation of protein modification process [inference]

regulation of protein phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity [inference]

negative regulation of protein kinase activity by regulation of protein phosphorylation

regulation of protein kinase activity [inference]

negative regulation of protein kinase activity [inference]

negative regulation of protein kinase activity by regulation of protein phosphorylation

regulation of eIF2 alpha phosphorylation by dsRNA

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity [inference]

negative regulation of protein kinase activity by regulation of protein phosphorylation

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

regulation of post-translational protein modification [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

regulation of protein modification by small protein conjugation or removal [inference]

regulation of protein ubiquitination [inference]

positive regulation of protein ubiquitination

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

positive regulation of translation

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity [inference]

negative regulation of protein kinase activity by regulation of protein phosphorylation

regulation of microtubule-based process [inference]

regulation of centrosome cycle [inference]

regulation of centrosome duplication

negative regulation of centrosome cycle [inference]

negative regulation of centrosome duplication

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

negative regulation of cell population proliferation

negative regulation of epithelial cell proliferation

regulation of epithelial cell proliferation [inference]

negative regulation of epithelial cell proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

regulation of muscle cell apoptotic process [inference]

negative regulation of muscle cell apoptotic process [inference]

negative regulation of striated muscle cell apoptotic process [inference]

negative regulation of cardiac muscle cell apoptotic process

regulation of striated muscle cell apoptotic process [inference]

negative regulation of striated muscle cell apoptotic process [inference]

negative regulation of cardiac muscle cell apoptotic process

regulation of cardiac muscle cell apoptotic process [inference]

negative regulation of cardiac muscle cell apoptotic process

negative regulation of apoptotic process

negative regulation of muscle cell apoptotic process [inference]

negative regulation of striated muscle cell apoptotic process [inference]

negative regulation of cardiac muscle cell apoptotic process

negative regulation of neuron apoptotic process

regulation of neuron apoptotic process

negative regulation of neuron apoptotic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of muscle cell apoptotic process [inference]

negative regulation of striated muscle cell apoptotic process [inference]

negative regulation of cardiac muscle cell apoptotic process

negative regulation of neuron apoptotic process

regulation of cellular component biogenesis [inference]

regulation of organelle assembly [inference]

regulation of centriole replication

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of translation

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of translation

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of DNA metabolic process

positive regulation of DNA replication

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

positive regulation of translation

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of cell cycle [inference]

positive regulation of cell cycle process [inference]

positive regulation of centrosome duplication

positive regulation of cell cycle phase transition [inference]

positive regulation of cell cycle G2/M phase transition

negative regulation of cellular process [inference]

negative regulation of cell population proliferation

negative regulation of epithelial cell proliferation

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA splicing [inference]

negative regulation of mRNA splicing, via spliceosome

negative regulation of phosphorus metabolic process [inference]

negative regulation of phosphate metabolic process [inference]

negative regulation of phosphorylation [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity [inference]

negative regulation of protein kinase activity by regulation of protein phosphorylation

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity [inference]

negative regulation of protein kinase activity by regulation of protein phosphorylation

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA splicing [inference]

negative regulation of mRNA splicing, via spliceosome

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of protein phosphorylation [inference]

negative regulation of protein kinase activity [inference]

negative regulation of protein kinase activity by regulation of protein phosphorylation

negative regulation of RNA metabolic process [inference]

negative regulation of mRNA metabolic process [inference]

negative regulation of mRNA processing [inference]

negative regulation of mRNA splicing, via spliceosome

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of mRNA metabolic process [inference]

negative regulation of mRNA processing [inference]

negative regulation of mRNA splicing, via spliceosome

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of muscle cell apoptotic process [inference]

negative regulation of striated muscle cell apoptotic process [inference]

negative regulation of cardiac muscle cell apoptotic process

negative regulation of neuron apoptotic process

negative regulation of cell cycle [inference]

negative regulation of cell cycle process [inference]

negative regulation of centrosome cycle [inference]

negative regulation of centrosome duplication

negative regulation of cellular component organization [inference]

negative regulation of organelle organization [inference]

negative regulation of cytoskeleton organization [inference]

negative regulation of centrosome cycle [inference]

negative regulation of centrosome duplication

regulation of cellular component organization [inference]

regulation of cell growth

regulation of organelle organization [inference]

negative regulation of organelle organization [inference]

negative regulation of cytoskeleton organization [inference]

negative regulation of centrosome cycle [inference]

negative regulation of centrosome duplication

regulation of cytoskeleton organization [inference]

negative regulation of cytoskeleton organization [inference]

negative regulation of centrosome cycle [inference]

negative regulation of centrosome duplication

regulation of organelle assembly [inference]

regulation of centriole replication

regulation of centrosome cycle [inference]

regulation of centrosome duplication

negative regulation of centrosome cycle [inference]

negative regulation of centrosome duplication

negative regulation of cellular component organization [inference]

negative regulation of organelle organization [inference]

negative regulation of cytoskeleton organization [inference]

negative regulation of centrosome cycle [inference]

negative regulation of centrosome duplication

regulation of cell cycle

regulation of cell cycle process [inference]

negative regulation of cell cycle process [inference]

negative regulation of centrosome cycle [inference]

negative regulation of centrosome duplication

regulation of centrosome cycle [inference]

regulation of centrosome duplication

negative regulation of centrosome cycle [inference]

negative regulation of centrosome duplication

positive regulation of cell cycle process [inference]

positive regulation of centrosome duplication

positive regulation of cell cycle phase transition [inference]

positive regulation of cell cycle G2/M phase transition

regulation of cell cycle phase transition [inference]

positive regulation of cell cycle phase transition [inference]

positive regulation of cell cycle G2/M phase transition

regulation of cell cycle G2/M phase transition [inference]

positive regulation of cell cycle G2/M phase transition

negative regulation of cell cycle [inference]

negative regulation of cell cycle process [inference]

negative regulation of centrosome cycle [inference]

negative regulation of centrosome duplication

positive regulation of cell cycle [inference]

positive regulation of cell cycle process [inference]

positive regulation of centrosome duplication

positive regulation of cell cycle phase transition [inference]

positive regulation of cell cycle G2/M phase transition

regulation of cellular response to stress [inference]

regulation of biological quality [inference]

regulation of protein stability

protein stabilization

regulation of RNA stability [inference]

regulation of mRNA stability [inference]

regulation of mRNA stability involved in cellular response to UV

regulation of anatomical structure size [inference]

regulation of cellular component size [inference]

regulation of cell size [inference]

cell volume homeostasis

regulation of molecular function [inference]

negative regulation of molecular function [inference]

negative regulation of catalytic activity [inference]

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity [inference]

negative regulation of protein kinase activity by regulation of protein phosphorylation

regulation of catalytic activity [inference]

negative regulation of catalytic activity [inference]

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity [inference]

negative regulation of protein kinase activity by regulation of protein phosphorylation

regulation of transferase activity [inference]

regulation of kinase activity [inference]

negative regulation of kinase activity [inference]

negative regulation of protein kinase activity [inference]

negative regulation of protein kinase activity by regulation of protein phosphorylation

regulation of protein kinase activity [inference]

negative regulation of protein kinase activity [inference]

negative regulation of protein kinase activity by regulation of protein phosphorylation

Displaying entries **1 - 5** of 37 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
granular component	IDA	PMID
nucleus	ISS	GO_REF
nucleus	ISO	GO_REF
nucleus	IDA	PMID
nucleus	IEA	GO_REF

GO Hierarchy

cellular component

protein-containing complex

protein-DNA complex

ribonucleoprotein complex

ribosomal subunit [inference]

cellular anatomical structure [inference]

microtubule organizing center [inference]

centrosome

spindle pole centrosome

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

membraneless organelle [inference]

intracellular membraneless organelle [inference]

nucleolus

nuclear body [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

ribonucleoprotein granule [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular membraneless organelle [inference]

nucleolus

nuclear body [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

ribonucleoprotein granule [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

supramolecular complex [inference]

ribonucleoprotein granule [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

Displaying entries **1 - 5** of 45 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
core promoter sequence-specific DNA binding	ISO	GO_REF
core promoter sequence-specific DNA binding	IEA	GO_REF
p53 binding	ISO	GO_REF
DNA binding	ISO	GO_REF
chromatin binding	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

nucleic acid binding [inference]

transcription regulatory region nucleic acid binding [inference]

transcription cis-regulatory region binding [inference]

core promoter sequence-specific DNA binding

DNA binding

double-stranded DNA binding [inference]

sequence-specific double-stranded DNA binding [inference]

transcription cis-regulatory region binding [inference]

core promoter sequence-specific DNA binding

sequence-specific DNA binding [inference]

sequence-specific double-stranded DNA binding [inference]

transcription cis-regulatory region binding [inference]

core promoter sequence-specific DNA binding

RNA binding

rRNA binding

chromatin binding

protein binding [inference]

p53 binding

transcription factor binding [inference]

DNA-binding transcription factor binding

RNA polymerase II-specific DNA-binding transcription factor binding [inference]

enzyme binding

kinase binding [inference]

protein kinase binding

protein kinase B binding

histone binding

identical protein binding

protein homodimerization activity

protein dimerization activity [inference]

protein homodimerization activity

unfolded protein binding

lipid binding [inference]

phospholipid binding [inference]

phosphatidylinositol phosphate binding [inference]

phosphatidylinositol-3,4,5-trisphosphate binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

phosphatidylinositol-3,4,5-trisphosphate binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

protein-containing complex binding [inference]

ribonucleoprotein complex binding [inference]

ribosome binding [inference]

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

molecular adaptor activity

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme inhibitor activity [inference]

kinase inhibitor activity [inference]

protein kinase inhibitor activity

kinase regulator activity [inference]

kinase inhibitor activity [inference]

protein kinase inhibitor activity

protein kinase regulator activity [inference]

protein kinase inhibitor activity

molecular function inhibitor activity [inference]

enzyme inhibitor activity [inference]

kinase inhibitor activity [inference]

protein kinase inhibitor activity

transcription regulator activity [inference]

transcription coregulator activity [inference]

transcription coactivator activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDEDDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	PubMed ID	GlyTouCan ID	Source
75	22645316 24788674 33300544 36288343 36852467 37453647 39627609 40885482	G49108TO	The O-GlcNAc Database
82	22645316 24788674 33300544 36288343 36852467 37453647 39627609 40885482	G49108TO	The O-GlcNAc Database
86			GlyGen
88		G49108TO	GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 5** entries
Pathway Name	Organism
Deposition of new CENPA-containing nucleosomes at the centromere	Mus musculus
PKR-mediated signaling	Mus musculus
SUMOylation of transcription cofactors	Mus musculus
TFAP2A acts as a transcriptional repressor during retinoic acid induced cell differentiation	Mus musculus
TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain	Mus musculus

Disease

Displaying 1 entry
DO ID	Disease Name	Source
DOID:0050908	myelodysplastic syndrome	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements