GlyCosmos Portal

Submissions

E3 ubiquitin-protein ligase TRIM21

Summary

UniProt ID: Q62191
Gene Symbol: Ro52 Ssa1 Trim21
Gene ID
Organism: Mus musculus (house mouse)

External Links

PubChem: Q62191
The O-GlcNAc Database: Q62191
Re-Glyco: Q62191

Annotation

Keyword: 3D-structure Cell cycle Coiled coil Cytoplasm Cytoplasmic vesicle DNA-binding Direct protein sequencing Nucleus RNA-binding Reference proteome Ribonucleoprotein Transferase Ubl conjugation Ubl conjugation pathway Zinc-finger

Gene Ontology (GO)

Displaying entries **1 - 5** of 43 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
autophagosome assembly	ISO	GO_REF
protein polyubiquitination	ISS	GO_REF
protein polyubiquitination	ISO	GO_REF
protein monoubiquitination	ISS	GO_REF
protein monoubiquitination	ISO	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune response [inference]

innate immune response

antiviral innate immune response

cellular process [inference]

signal transduction [inference]

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

canonical NF-kappaB signal transduction

metabolic process [inference]

catabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

proteasomal protein catabolic process

macromolecule metabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

proteasomal protein catabolic process

protein metabolic process [inference]

protein catabolic process [inference]

proteasomal protein catabolic process

protein modification process [inference]

post-translational protein modification [inference]

protein modification by small protein conjugation or removal [inference]

protein modification by small protein conjugation [inference]

protein ubiquitination

protein polyubiquitination

macromolecule modification [inference]

protein modification process [inference]

post-translational protein modification [inference]

protein modification by small protein conjugation or removal [inference]

protein modification by small protein conjugation [inference]

protein ubiquitination

protein polyubiquitination

primary metabolic process [inference]

protein metabolic process [inference]

protein catabolic process [inference]

proteasomal protein catabolic process

protein modification process [inference]

post-translational protein modification [inference]

protein modification by small protein conjugation or removal [inference]

protein modification by small protein conjugation [inference]

protein ubiquitination

protein polyubiquitination

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

vacuole organization [inference]

autophagosome organization [inference]

autophagosome assembly

organelle assembly [inference]

autophagosome assembly

membraneless organelle assembly [inference]

stress granule assembly

organelle disassembly [inference]

stress granule disassembly

cellular component disassembly [inference]

protein-containing complex disassembly [inference]

protein-RNA complex disassembly [inference]

stress granule disassembly

organelle disassembly [inference]

stress granule disassembly

cellular component assembly [inference]

organelle assembly [inference]

autophagosome assembly

membraneless organelle assembly [inference]

stress granule assembly

protein-containing complex organization [inference]

protein-containing complex disassembly [inference]

protein-RNA complex disassembly [inference]

stress granule disassembly

protein-RNA complex organization [inference]

protein-RNA complex disassembly [inference]

stress granule disassembly

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

response to virus [inference]

defense response to virus [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

antiviral innate immune response

response to stimulus [inference]

response to stress [inference]

defense response [inference]

inflammatory response [inference]

pyroptotic inflammatory response

defense response to virus [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

antiviral innate immune response

immune response [inference]

innate immune response

antiviral innate immune response

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to virus [inference]

defense response to virus [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

antiviral innate immune response

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to virus [inference]

defense response to virus [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

antiviral innate immune response

response to chemical [inference]

response to peptide [inference]

response to cytokine [inference]

response to type II interferon

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

negative regulation of immune system process [inference]

negative regulation of immune response [inference]

negative regulation of innate immune response

regulation of immune response [inference]

regulation of innate immune response [inference]

negative regulation of innate immune response

negative regulation of immune response [inference]

negative regulation of innate immune response

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of non-canonical NF-kappaB signal transduction

regulation of intracellular signal transduction [inference]

regulation of non-canonical NF-kappaB signal transduction [inference]

positive regulation of non-canonical NF-kappaB signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of non-canonical NF-kappaB signal transduction

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of non-canonical NF-kappaB signal transduction

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of non-canonical NF-kappaB signal transduction

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of autophagy

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of non-canonical NF-kappaB signal transduction

positive regulation of cell cycle

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of non-canonical NF-kappaB signal transduction

negative regulation of biological process [inference]

negative regulation of immune system process [inference]

negative regulation of immune response [inference]

negative regulation of innate immune response

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein deubiquitination

negative regulation of viral process [inference]

negative regulation of viral transcription

negative regulation of response to stimulus [inference]

negative regulation of response to biotic stimulus [inference]

negative regulation of innate immune response

negative regulation of defense response [inference]

negative regulation of innate immune response

negative regulation of response to external stimulus [inference]

negative regulation of innate immune response

negative regulation of immune response [inference]

negative regulation of innate immune response

regulation of response to stimulus [inference]

regulation of response to biotic stimulus [inference]

negative regulation of response to biotic stimulus [inference]

negative regulation of innate immune response

regulation of innate immune response [inference]

negative regulation of innate immune response

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of non-canonical NF-kappaB signal transduction

regulation of intracellular signal transduction [inference]

regulation of non-canonical NF-kappaB signal transduction [inference]

positive regulation of non-canonical NF-kappaB signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of non-canonical NF-kappaB signal transduction

regulation of response to external stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of innate immune response

regulation of innate immune response [inference]

negative regulation of innate immune response

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of non-canonical NF-kappaB signal transduction

negative regulation of response to stimulus [inference]

negative regulation of response to biotic stimulus [inference]

negative regulation of innate immune response

negative regulation of defense response [inference]

negative regulation of innate immune response

negative regulation of response to external stimulus [inference]

negative regulation of innate immune response

negative regulation of immune response [inference]

negative regulation of innate immune response

regulation of immune response [inference]

regulation of innate immune response [inference]

negative regulation of innate immune response

negative regulation of immune response [inference]

negative regulation of innate immune response

regulation of response to stress [inference]

regulation of defense response [inference]

negative regulation of defense response [inference]

negative regulation of innate immune response

regulation of innate immune response [inference]

negative regulation of innate immune response

regulation of viral process [inference]

regulation of viral transcription [inference]

negative regulation of viral transcription

negative regulation of viral process [inference]

negative regulation of viral transcription

regulation of cellular process [inference]

signal transduction [inference]

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

canonical NF-kappaB signal transduction

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of non-canonical NF-kappaB signal transduction

regulation of intracellular signal transduction [inference]

regulation of non-canonical NF-kappaB signal transduction [inference]

positive regulation of non-canonical NF-kappaB signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of non-canonical NF-kappaB signal transduction

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of non-canonical NF-kappaB signal transduction

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression

negative regulation of metabolic process [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein deubiquitination

positive regulation of metabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of autophagy

regulation of catabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of autophagy

regulation of autophagy [inference]

positive regulation of autophagy

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein deubiquitination

regulation of protein metabolic process [inference]

regulation of protein modification process [inference]

negative regulation of protein modification process [inference]

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein deubiquitination

regulation of post-translational protein modification [inference]

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein deubiquitination

regulation of protein modification by small protein conjugation or removal [inference]

regulation of protein deubiquitination [inference]

negative regulation of protein deubiquitination

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein deubiquitination

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein deubiquitination

regulation of primary metabolic process [inference]

regulation of protein metabolic process [inference]

regulation of protein modification process [inference]

negative regulation of protein modification process [inference]

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein deubiquitination

regulation of post-translational protein modification [inference]

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein deubiquitination

regulation of protein modification by small protein conjugation or removal [inference]

regulation of protein deubiquitination [inference]

negative regulation of protein deubiquitination

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein deubiquitination

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein deubiquitination

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of autophagy

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of non-canonical NF-kappaB signal transduction

positive regulation of cell cycle

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein deubiquitination

regulation of cell cycle [inference]

positive regulation of cell cycle

regulation of biological quality [inference]

regulation of protein stability [inference]

protein destabilization

regulation of molecular function [inference]

positive regulation of molecular function [inference]

positive regulation of binding [inference]

positive regulation of protein binding

regulation of binding [inference]

regulation of protein binding [inference]

positive regulation of protein binding

positive regulation of binding [inference]

positive regulation of protein binding

Displaying entries **1 - 5** of 18 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
P-body	IEA	GO_REF
nucleus	ISS	GO_REF
nucleus	ISO	GO_REF
nucleus	EXP	PMID
nucleus	IEA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

ribonucleoprotein complex

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle

intracellular membrane-bounded organelle [inference]

nucleus

vacuole [inference]

autophagosome

intracellular vesicle [inference]

cytoplasmic vesicle

membraneless organelle [inference]

intracellular membraneless organelle [inference]

ribonucleoprotein granule [inference]

cytoplasmic ribonucleoprotein granule [inference]

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

vacuole [inference]

autophagosome

intracellular vesicle [inference]

cytoplasmic vesicle

intracellular membraneless organelle [inference]

ribonucleoprotein granule [inference]

cytoplasmic ribonucleoprotein granule [inference]

supramolecular complex [inference]

ribonucleoprotein granule [inference]

cytoplasmic ribonucleoprotein granule [inference]

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
DNA binding
transcription coactivator activity	ISO	GO_REF
RNA binding
ubiquitin-protein transferase activity	ISS	GO_REF
ubiquitin-protein transferase activity	ISO	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

acyltransferase activity [inference]

aminoacyltransferase activity [inference]

ubiquitin-like protein transferase activity [inference]

ubiquitin-protein transferase activity

ubiquitin protein ligase activity

ubiquitin-like protein ligase activity [inference]

ubiquitin protein ligase activity

catalytic activity, acting on a protein [inference]

ubiquitin-like protein transferase activity [inference]

ubiquitin-protein transferase activity

ubiquitin protein ligase activity

ubiquitin-like protein ligase activity [inference]

ubiquitin protein ligase activity

binding [inference]

nucleic acid binding [inference]

protein binding [inference]

identical protein binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

zinc ion binding

transcription regulator activity [inference]

transcription coregulator activity [inference]

transcription coactivator activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MSPSTTSKMSLEKMWEEVTCSICLDPMVEPMSIECGHCFCKECIFEVGKNGGSSCPECRQQFLLRNLRPNRHIANMVENLKQIAQNTKKSTQETHCMKHGEKLHLFCEEDGQALCWVCAQSGKHRDHTRVPIEEAAKVYQEKIHVVLEKLRKGKELAEKMEMDLTMQRTDWKRNIDTQKSRIHAEFALQNSLLAQEEQRQLQRLEKDQREYLRLLGKKEAELAEKNQALQELISELERRIRGSELELLQEVRIILERSGSWNLDTLDIDAPDLTSTCPVPGRKKMLRTCWVHITLDRNTANSWLIISKDRRQVRMGDTHQNVSDNKERFSNYPMVLGAQRFSSGKMYWEVDVTQKEAWDLGVCRDSVQRKGQFSLSPENGFWTIWLWQDSYEAGTSPQTTLHIQVPPCQIGIFVDYEAGVVSFYNITDHGSLIYTFSECVFAGPLRPFFNVGFNYSGGNAAPLKLCPLKM

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
169		40885482	G49108TO	The O-GlcNAc Database
177		40885482	G49108TO	The O-GlcNAc Database

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 3** entries
Pathway Name	Organism
Antigen processing: Ubiquitination & Proteasome degradation	Mus musculus
KEAP1-NFE2L2 pathway	Mus musculus
Regulation of innate immune responses to cytosolic DNA	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements