GlyCosmos Portal

Submissions

Splicing factor 3A subunit 2

Summary

UniProt ID: Q62203
Gene Symbol: Sap62 Sf3a2
Gene ID
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q62203
PubChem: Q62203
Re-Glyco: Q62203

Annotation

Keyword: Acetylation Nucleus Phosphoprotein Reference proteome Repeat Spliceosome Zinc-finger

Gene Ontology (GO)

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
spliceosomal complex assembly	IBA	GO_REF
RNA splicing, via transesterification reactions	TAS	PMID
mRNA splicing, via spliceosome	ISS	GO_REF
mRNA splicing, via spliceosome	ISO	GO_REF
mRNA splicing, via spliceosome	TAS	PMID

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

macromolecule metabolic process [inference]

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

mRNA metabolic process [inference]

mRNA processing

mRNA splicing, via spliceosome

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

mRNA metabolic process [inference]

mRNA processing

mRNA splicing, via spliceosome

RNA processing [inference]

mRNA processing

mRNA splicing, via spliceosome

RNA splicing [inference]

RNA splicing, via transesterification reactions

RNA splicing, via transesterification reactions with bulged adenosine as nucleophile [inference]

mRNA splicing, via spliceosome

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cellular component assembly [inference]

protein-containing complex assembly [inference]

protein-RNA complex assembly [inference]

spliceosomal complex assembly

U2-type prespliceosome assembly

protein-containing complex organization [inference]

protein-containing complex assembly [inference]

protein-RNA complex assembly [inference]

spliceosomal complex assembly

U2-type prespliceosome assembly

protein-RNA complex organization [inference]

protein-RNA complex assembly [inference]

spliceosomal complex assembly

U2-type prespliceosome assembly

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development

regulation of cellular process [inference]

positive regulation of cellular process [inference]

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development

regulation of cellular component organization [inference]

regulation of cell projection organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development

regulation of plasma membrane bounded cell projection organization [inference]

regulation of neuron projection development [inference]

positive regulation of neuron projection development

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of neuron projection development

Displaying entries **1 - 5** of 16 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
nucleus	ISS	PMID
nucleus	ISO	GO_REF
nucleus	IEA	GO_REF GO_REF GO_REF
nucleoplasm	ISO	GO_REF
spliceosomal complex	ISO	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

Sm-like protein family complex [inference]

small nuclear ribonucleoprotein complex [inference]

spliceosomal snRNP complex [inference]

U2 snRNP

nuclear protein-containing complex [inference]

spliceosomal complex

U2-type spliceosomal complex

prespliceosome [inference]

U2-type prespliceosome

precatalytic spliceosome [inference]

U2-type precatalytic spliceosome

catalytic step 2 spliceosome

small nuclear ribonucleoprotein complex [inference]

spliceosomal snRNP complex [inference]

U2 snRNP

catalytic complex [inference]

catalytic step 2 spliceosome

ribonucleoprotein complex [inference]

spliceosomal complex

U2-type spliceosomal complex

prespliceosome [inference]

U2-type prespliceosome

precatalytic spliceosome [inference]

U2-type precatalytic spliceosome

catalytic step 2 spliceosome

small nuclear ribonucleoprotein complex [inference]

spliceosomal snRNP complex [inference]

U2 snRNP

cellular anatomical structure [inference]

nucleoplasm

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

membraneless organelle [inference]

intracellular membraneless organelle [inference]

nuclear body [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

ribonucleoprotein granule [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular membraneless organelle [inference]

nuclear body [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

ribonucleoprotein granule [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

supramolecular complex [inference]

ribonucleoprotein granule [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

Displaying **all 2** entries
GO Term	Evidence Code	Reference
nucleic acid binding	IEA	GO_REF
zinc ion binding	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

nucleic acid binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

zinc ion binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEQVKVEVKKFVKIGRPGYKVTKQRDTEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFFFLQFHFKMEKPPAPPSLPAGPPGVKRPPPPLMNGLPPRPPLPDALPPPPPGGLPLPPMPPTGPAPSGPPGPPQMPPPAPGVHPPAPVVHPPTSGVHPPAPGVHPPAPVVHPPTSGVHPPAPGVHPPTPGVHPPAPGVHPPAPGVHPPAPGVHPPTPGVHPPAPGVHPPAPGVHPPAPGVHPPPSAGVHPQAPGVHPPAPAVHPQAPGVHPPAPGIHPQAPGVHPQPPPGVHPAAPGVHPQPPGVHPSNPGVHPAPMPPMLRPPLPSDGPGNMPPPPPGN

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
323				GlyGen
351				GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
mRNA Polyadenylation	Mus musculus
pre-mRNA splicing	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements