GlyCosmos Portal

Submissions

Proprotein convertase subtilisin/kexin type 6

Summary

UniProt ID: Q63415
Gene Symbol: Pace4 Pcsk6
Gene ID: 25507
Organism: Rattus norvegicus (Norway rat)

External Links

PubChem: Q63415
Re-Glyco: Q63415

Annotation

Keyword: Calcium Cleavage on pair of basic residues Glycoprotein Reference proteome Repeat Serine protease Signal Zymogen

Gene Ontology (GO)

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
zygotic determination of anterior/posterior axis, embryo	ISO	GO_REF
determination of left/right symmetry	ISO	GO_REF
glycoprotein metabolic process	ISO	GO_REF
protein processing	ISO	GO_REF
peptide hormone processing	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

hormone metabolic process [inference]

peptide hormone processing

macromolecule metabolic process [inference]

protein metabolic process [inference]

proteolysis [inference]

protein processing

signaling receptor ligand precursor processing [inference]

peptide hormone processing

glycoprotein metabolic process

protein maturation [inference]

protein processing

signaling receptor ligand precursor processing [inference]

peptide hormone processing

primary metabolic process [inference]

protein metabolic process [inference]

proteolysis [inference]

protein processing

signaling receptor ligand precursor processing [inference]

peptide hormone processing

glycoprotein metabolic process

protein maturation [inference]

protein processing

signaling receptor ligand precursor processing [inference]

peptide hormone processing

carbohydrate derivative metabolic process [inference]

glycoprotein metabolic process

export from cell [inference]

secretion by cell

multicellular organismal process [inference]

pattern specification process [inference]

axis specification [inference]

embryonic axis specification [inference]

anterior/posterior axis specification, embryo [inference]

zygotic determination of anterior/posterior axis, embryo

anterior/posterior axis specification [inference]

anterior/posterior axis specification, embryo [inference]

zygotic determination of anterior/posterior axis, embryo

specification of symmetry [inference]

determination of bilateral symmetry [inference]

determination of left/right symmetry

embryonic pattern specification [inference]

embryonic axis specification [inference]

anterior/posterior axis specification, embryo [inference]

zygotic determination of anterior/posterior axis, embryo

neurotrophin production [inference]

nerve growth factor production

localization [inference]

establishment of localization [inference]

transport [inference]

secretion [inference]

secretion by cell

export from cell [inference]

secretion by cell

biological regulation [inference]

regulation of biological quality [inference]

regulation of hormone levels [inference]

hormone metabolic process [inference]

peptide hormone processing

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
obsolete extracellular space
cell surface	ISO	GO_REF
cell surface	IBA	GO_REF
membrane	IBA	GO_REF
extracellular matrix	ISO	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

external encapsulating structure [inference]

extracellular matrix

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
endopeptidase activity	ISO	GO_REF
serine-type endopeptidase activity	ISO	GO_REF
serine-type endopeptidase activity	IBA	GO_REF
serine-type endopeptidase activity	IEA	GO_REF
heparin binding	ISO	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

peptidase activity [inference]

endopeptidase activity

serine-type endopeptidase activity

serine-type peptidase activity [inference]

serine-type endopeptidase activity

serine hydrolase activity [inference]

serine-type peptidase activity [inference]

serine-type endopeptidase activity

catalytic activity, acting on a protein [inference]

peptidase activity [inference]

endopeptidase activity

serine-type endopeptidase activity

serine-type peptidase activity [inference]

serine-type endopeptidase activity

binding [inference]

protein binding [inference]

growth factor binding [inference]

neurotrophin binding [inference]

nerve growth factor binding

carbohydrate derivative binding [inference]

glycosaminoglycan binding [inference]

heparin binding

sulfur compound binding [inference]

heparin binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MPPRAPPAPGPRPPPRAAGRHGLSPLAPRPWRWLLLLALPAVCSALPPPRPVYTNHWAVQVLGGPGAADRVAAAHGYLNLGQIGNLDDYYHFYHSKTFKRSTLSSRGPHTFLRMDPQVKWLQQQEVKRRVKRQARSDSLYFNDPIWSNMWYMHCADKNSRCRSEMNVQAAWKRGYTGKNVVVTILDDGIERNHPDLAPNYDSYASYDVNGNDYDPSPRYDASNENKHGTRCAGEVAASANNSYCIVGIAYNAKIGGIRMLDGDVTDVVEAKSLGIRPNYIDIYSASWGPDDDGKTVDGPGRLAKQAFEYGIKKGRQGLGSIFVWASGNGGREGDHCSCDGYTNSIYTISVSSTTENGHKPWYLEECASTLATTYSSGAFYERKIVTTDLRQRCTDGHTGTSVSAPMVAGIIALALEANNQLTWRDVQHLLVKTSRPAHLKASDWKVNGAGHKVSHLYGFGLVDAEALVLEARKWTAVPSQHMCVATADKRPRSIPVVQVLRTTALTNACADHSDQRVVYLEHVVVRISISHPRRGDLQIHLISPSGTKSQLLAKRLLDFSNEGFTNWEFMTVHCWGEKAEGEWTLEVQDIPSQVRNPEKQGKLKEWSLILYGTAEHPYRTFSSHQSRSRMLELSVPEQEPLKAEGPPPQAETPEEEEEYTGVCHPECGDKGCDGPSADQCLNCVHFSLGNSKTNRKCVSECPLGYFGDTAARRCRRCHKGCETCTGRSPTQCLSCRRGFYHHQETNTCVTLCPAGLYADESQRLCLRCHPSCQKCVDEPEKSTVCKEGFSLARGSCIPDCEPGTYFDSELIRCGECHHTCRTCVGPSREECIHCAKSFHFQDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCEGSSRNCSRCKAGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	Description	Source
240	N-linked (GlcNAc...) asparagine	UniProt
882	N-linked (GlcNAc...) asparagine	UniProt
900	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 3** entries
Pathway Name	Organism
Assembly of active LPL and LIPC lipase complexes	Rattus norvegicus
NGF processing	Rattus norvegicus
Regulation of CDH1 posttranslational processing and trafficking to plasma membrane	Rattus norvegicus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements