GlyCosmos Portal

Submissions

PAN2-PAN3 deadenylation complex subunit Pan3

Summary

UniProt ID: Q640Q5
Gene Symbol: Pan3
Gene ID: 72587
Organism: Mus musculus (house mouse)

External Links

GlyGen: Q640Q5
PubChem: Q640Q5
Re-Glyco: Q640Q5

Annotation

Keyword: ATP-binding Alternative splicing Coiled coil Cytoplasm Nucleus Phosphoprotein Reference proteome Zinc-finger mRNA processing

Gene Ontology (GO)

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
nuclear-transcribed mRNA poly(A) tail shortening	ISO	GO_REF
nuclear-transcribed mRNA poly(A) tail shortening	IBA	GO_REF
nuclear-transcribed mRNA poly(A) tail shortening	IEA	GO_REF GO_REF
deadenylation-dependent decapping of nuclear-transcribed mRNA	IMP	PMID
mRNA processing

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

catabolic process [inference]

macromolecule catabolic process [inference]

nucleic acid catabolic process [inference]

RNA catabolic process [inference]

mRNA catabolic process [inference]

nuclear-transcribed mRNA catabolic process [inference]

nucleobase-containing compound catabolic process [inference]

nucleic acid catabolic process [inference]

RNA catabolic process [inference]

mRNA catabolic process [inference]

nuclear-transcribed mRNA catabolic process [inference]

macromolecule metabolic process [inference]

macromolecule catabolic process [inference]

nucleic acid catabolic process [inference]

RNA catabolic process [inference]

mRNA catabolic process [inference]

nuclear-transcribed mRNA catabolic process [inference]

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

RNA catabolic process [inference]

mRNA catabolic process [inference]

nuclear-transcribed mRNA catabolic process [inference]

mRNA metabolic process [inference]

mRNA processing

mRNA catabolic process [inference]

nuclear-transcribed mRNA catabolic process [inference]

mRNA methylguanosine-cap decapping [inference]

deadenylation-dependent decapping of nuclear-transcribed mRNA

RNA decapping [inference]

mRNA methylguanosine-cap decapping [inference]

deadenylation-dependent decapping of nuclear-transcribed mRNA

nucleic acid catabolic process [inference]

RNA catabolic process [inference]

mRNA catabolic process [inference]

nuclear-transcribed mRNA catabolic process [inference]

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound catabolic process [inference]

nucleic acid catabolic process [inference]

RNA catabolic process [inference]

mRNA catabolic process [inference]

nuclear-transcribed mRNA catabolic process [inference]

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

RNA catabolic process [inference]

mRNA catabolic process [inference]

nuclear-transcribed mRNA catabolic process [inference]

mRNA metabolic process [inference]

mRNA processing

mRNA catabolic process [inference]

nuclear-transcribed mRNA catabolic process [inference]

mRNA methylguanosine-cap decapping [inference]

deadenylation-dependent decapping of nuclear-transcribed mRNA

RNA decapping [inference]

mRNA methylguanosine-cap decapping [inference]

deadenylation-dependent decapping of nuclear-transcribed mRNA

nucleic acid catabolic process [inference]

RNA catabolic process [inference]

mRNA catabolic process [inference]

nuclear-transcribed mRNA catabolic process [inference]

RNA processing [inference]

mRNA processing

localization [inference]

establishment of localization [inference]

establishment of protein localization [inference]

protein targeting

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of cellular component biogenesis [inference]

positive regulation of organelle assembly [inference]

positive regulation of cytoplasmic mRNA processing body assembly

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of organelle assembly [inference]

positive regulation of cytoplasmic mRNA processing body assembly

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

mRNA catabolic process [inference]

nuclear-transcribed mRNA catabolic process [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

mRNA catabolic process [inference]

nuclear-transcribed mRNA catabolic process [inference]

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

mRNA catabolic process [inference]

nuclear-transcribed mRNA catabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

negative regulation of gene expression [inference]

mRNA catabolic process [inference]

nuclear-transcribed mRNA catabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

mRNA catabolic process [inference]

nuclear-transcribed mRNA catabolic process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

mRNA catabolic process [inference]

nuclear-transcribed mRNA catabolic process [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

mRNA catabolic process [inference]

nuclear-transcribed mRNA catabolic process [inference]

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

negative regulation of gene expression [inference]

mRNA catabolic process [inference]

nuclear-transcribed mRNA catabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

mRNA catabolic process [inference]

nuclear-transcribed mRNA catabolic process [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

mRNA catabolic process [inference]

nuclear-transcribed mRNA catabolic process [inference]

regulation of cellular component biogenesis [inference]

positive regulation of cellular component biogenesis [inference]

positive regulation of organelle assembly [inference]

positive regulation of cytoplasmic mRNA processing body assembly

regulation of organelle assembly [inference]

regulation of cytoplasmic mRNA processing body assembly [inference]

positive regulation of cytoplasmic mRNA processing body assembly

positive regulation of organelle assembly [inference]

positive regulation of cytoplasmic mRNA processing body assembly

positive regulation of cellular process [inference]

positive regulation of cellular component biogenesis [inference]

positive regulation of organelle assembly [inference]

positive regulation of cytoplasmic mRNA processing body assembly

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of organelle assembly [inference]

positive regulation of cytoplasmic mRNA processing body assembly

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

mRNA catabolic process [inference]

nuclear-transcribed mRNA catabolic process [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

mRNA catabolic process [inference]

nuclear-transcribed mRNA catabolic process [inference]

regulation of cellular component organization [inference]

regulation of organelle organization [inference]

positive regulation of organelle organization [inference]

positive regulation of organelle assembly [inference]

positive regulation of cytoplasmic mRNA processing body assembly

regulation of organelle assembly [inference]

regulation of cytoplasmic mRNA processing body assembly [inference]

positive regulation of cytoplasmic mRNA processing body assembly

positive regulation of organelle assembly [inference]

positive regulation of cytoplasmic mRNA processing body assembly

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of organelle assembly [inference]

positive regulation of cytoplasmic mRNA processing body assembly

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
P-body	IDA	PMID
P-body	IBA	GO_REF
P-body	IEA	GO_REF GO_REF
nucleus	ISS	GO_REF
nucleus	ISO	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

catalytic complex [inference]

exoribonuclease complex [inference]

PAN complex

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

membraneless organelle [inference]

intracellular membraneless organelle [inference]

ribonucleoprotein granule [inference]

cytoplasmic ribonucleoprotein granule [inference]

P-body

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular membraneless organelle [inference]

ribonucleoprotein granule [inference]

cytoplasmic ribonucleoprotein granule [inference]

P-body

supramolecular complex [inference]

ribonucleoprotein granule [inference]

cytoplasmic ribonucleoprotein granule [inference]

P-body

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
poly(A)-specific ribonuclease activity	ISO	GO_REF
poly(A)-specific ribonuclease activity	IEA	GO_REF
protein kinase activity	IEA	GO_REF
ATP binding	IEA	GO_REF GO_REF
poly(A) binding	IBA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

transferase activity, transferring phosphorus-containing groups [inference]

kinase activity [inference]

protein kinase activity

phosphotransferase activity, alcohol group as acceptor [inference]

protein kinase activity

hydrolase activity [inference]

hydrolase activity, acting on ester bonds [inference]

exonuclease activity [inference]

RNA exonuclease activity [inference]

RNA exonuclease activity, producing 5'-phosphomonoesters [inference]

3'-5'-RNA exonuclease activity [inference]

poly(A)-specific ribonuclease activity

3'-5' exonuclease activity [inference]

3'-5'-RNA exonuclease activity [inference]

poly(A)-specific ribonuclease activity

catalytic activity, acting on a protein [inference]

protein kinase activity

catalytic activity, acting on a nucleic acid [inference]

nuclease activity [inference]

exonuclease activity [inference]

RNA exonuclease activity [inference]

RNA exonuclease activity, producing 5'-phosphomonoesters [inference]

3'-5'-RNA exonuclease activity [inference]

poly(A)-specific ribonuclease activity

3'-5' exonuclease activity [inference]

3'-5'-RNA exonuclease activity [inference]

poly(A)-specific ribonuclease activity

RNA nuclease activity [inference]

RNA exonuclease activity [inference]

RNA exonuclease activity, producing 5'-phosphomonoesters [inference]

3'-5'-RNA exonuclease activity [inference]

poly(A)-specific ribonuclease activity

catalytic activity, acting on RNA [inference]

RNA nuclease activity [inference]

RNA exonuclease activity [inference]

RNA exonuclease activity, producing 5'-phosphomonoesters [inference]

3'-5'-RNA exonuclease activity [inference]

poly(A)-specific ribonuclease activity

binding [inference]

nucleic acid binding [inference]

RNA binding [inference]

single-stranded RNA binding [inference]

poly-purine tract binding [inference]

poly(A) binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

ATP binding

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

zinc ion binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MNSGGGGGLPPPSAAASPSSSSLAAAVAVAVAASSGVGGVPGGPAAAAGVKLKYCRYYAKDKTCFYGEECQFLHEDPAAGAAPGLGLHSNSVPLALAAAAGAAFPPGALPGGGAGPPAGPKKPELGVPGAATAGGGLDGPRVAIPGMDGGALTDASLTESYFSTSFIGVNGFGSPVETKYPLMQRMTSSSSSPSLLNDSAKPYTGHDLLTSSASSLFNDFGALNISQRRKPRKYRLGMLEERLVPMGSQARKAKNPLGCLADRCESGVPVSMVWWDRVPENNLQTPNPTASEFIPKGGSTSRLSNVSQSNMSAFSQVFSHPSMGSPATAGLAPGMSLSAGSSPLHSPKITPHTSPAPRRRSHTPNPASFMVPPSASTPANNPAPQPPSSGQVIQKETVGGTTYFYTDTTPAPLTGMVFPNYHIYPPTAPHVAYMQPKANAPSFFMADELRQELINRHLITMAQIDQADMPAVPTEVDSYHSLFPLEPLPPPNRIQKSSNFGYITSCYKAVNSKDDLPYCLRRIHGFRLVNTKCMVLVDMWKKIQHSNIVTLREVFTTKAFAEPSLVFAYDFHAGGETMMSRHFNDPNSDAYFTKRKWGQHDGPLPRQHAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPTKILITSKTRLRVNCVGVFDVLTFDNSQNNNPLALMAQYQQADLISLGKVVLALACNSLAGIQRENLQKAMELVTINYSSDLKNLILYLLTDQNRMRSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERPEFQKDPTWSETGDRYLLKLFRDHLFHQVTEAGAPWIDLSHIISCLNKLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAANGQL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
377				GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Deadenylation of mRNA	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements