GlyCosmos Portal

Submissions

Carboxylesterase 1E

Summary

UniProt ID: Q64176
Gene Symbol: Ces1e Es22
Gene ID: 13897
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0005620
PubChem: Q64176
Re-Glyco: Q64176

Annotation

Keyword: Direct protein sequencing Disulfide bond Glycoprotein Membrane Microsome Reference proteome Serine esterase Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 16 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
retinoid metabolic process	IDA	PMID
cholesterol biosynthetic process	ISO	GO_REF
cholesterol metabolic process	ISO	GO_REF
positive regulation of cholesterol efflux	ISO	GO_REF
negative regulation of cholesterol storage	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

catabolic process [inference]

lipid catabolic process

biosynthetic process [inference]

lipid biosynthetic process [inference]

steroid biosynthetic process [inference]

sterol biosynthetic process [inference]

cholesterol biosynthetic process

isoprenoid biosynthetic process [inference]

terpenoid biosynthetic process [inference]

diterpenoid biosynthetic process [inference]

vitamin A biosynthetic process

small molecule biosynthetic process [inference]

vitamin biosynthetic process [inference]

fat-soluble vitamin biosynthetic process [inference]

vitamin A biosynthetic process

alcohol biosynthetic process [inference]

secondary alcohol biosynthetic process [inference]

cholesterol biosynthetic process

primary metabolic process [inference]

lipid metabolic process [inference]

fatty acid metabolic process [inference]

medium-chain fatty acid metabolic process

isoprenoid metabolic process [inference]

terpenoid metabolic process [inference]

diterpenoid metabolic process [inference]

retinoid metabolic process

vitamin A metabolic process [inference]

vitamin A biosynthetic process

diterpenoid biosynthetic process [inference]

vitamin A biosynthetic process

terpenoid biosynthetic process [inference]

diterpenoid biosynthetic process [inference]

vitamin A biosynthetic process

isoprenoid biosynthetic process [inference]

terpenoid biosynthetic process [inference]

diterpenoid biosynthetic process [inference]

vitamin A biosynthetic process

steroid metabolic process [inference]

steroid biosynthetic process [inference]

sterol biosynthetic process [inference]

cholesterol biosynthetic process

sterol metabolic process [inference]

cholesterol metabolic process

cholesterol biosynthetic process

sterol biosynthetic process [inference]

cholesterol biosynthetic process

lipid biosynthetic process [inference]

steroid biosynthetic process [inference]

sterol biosynthetic process [inference]

cholesterol biosynthetic process

isoprenoid biosynthetic process [inference]

terpenoid biosynthetic process [inference]

diterpenoid biosynthetic process [inference]

vitamin A biosynthetic process

lipid catabolic process

small molecule metabolic process [inference]

alcohol metabolic process [inference]

alcohol biosynthetic process [inference]

secondary alcohol biosynthetic process [inference]

cholesterol biosynthetic process

secondary alcohol metabolic process [inference]

cholesterol metabolic process

cholesterol biosynthetic process

secondary alcohol biosynthetic process [inference]

cholesterol biosynthetic process

organic acid metabolic process [inference]

oxoacid metabolic process [inference]

carboxylic acid metabolic process [inference]

monocarboxylic acid metabolic process [inference]

fatty acid metabolic process [inference]

medium-chain fatty acid metabolic process

vitamin metabolic process [inference]

vitamin biosynthetic process [inference]

fat-soluble vitamin biosynthetic process [inference]

vitamin A biosynthetic process

small molecule biosynthetic process [inference]

vitamin biosynthetic process [inference]

fat-soluble vitamin biosynthetic process [inference]

vitamin A biosynthetic process

alcohol biosynthetic process [inference]

secondary alcohol biosynthetic process [inference]

cholesterol biosynthetic process

cellular developmental process [inference]

cell differentiation [inference]

epithelial cell differentiation

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to lipid [inference]

cellular response to sterol [inference]

cellular response to cholesterol

cellular response to oxygen-containing compound [inference]

cellular response to sterol [inference]

cellular response to cholesterol

cellular response to alcohol [inference]

cellular response to cholesterol

cellular response to lipoprotein particle stimulus [inference]

cellular response to low-density lipoprotein particle stimulus

developmental process [inference]

cellular developmental process [inference]

cell differentiation [inference]

epithelial cell differentiation

homeostatic process [inference]

chemical homeostasis [inference]

lipid homeostasis [inference]

sterol homeostasis [inference]

cholesterol homeostasis

response to stimulus [inference]

response to endogenous stimulus [inference]

response to lipoprotein particle [inference]

cellular response to low-density lipoprotein particle stimulus

response to chemical [inference]

response to lipid [inference]

response to sterol [inference]

cellular response to sterol [inference]

cellular response to cholesterol

response to cholesterol [inference]

cellular response to cholesterol

cellular response to lipid [inference]

cellular response to sterol [inference]

cellular response to cholesterol

response to lipoprotein particle [inference]

cellular response to low-density lipoprotein particle stimulus

cellular response to chemical stimulus [inference]

cellular response to lipid [inference]

cellular response to sterol [inference]

cellular response to cholesterol

cellular response to oxygen-containing compound [inference]

cellular response to sterol [inference]

cellular response to cholesterol

cellular response to alcohol [inference]

cellular response to cholesterol

response to oxygen-containing compound [inference]

response to sterol [inference]

cellular response to sterol [inference]

cellular response to cholesterol

response to cholesterol [inference]

cellular response to cholesterol

response to alcohol [inference]

response to cholesterol [inference]

cellular response to cholesterol

cellular response to alcohol [inference]

cellular response to cholesterol

cellular response to oxygen-containing compound [inference]

cellular response to sterol [inference]

cellular response to cholesterol

cellular response to alcohol [inference]

cellular response to cholesterol

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to lipid [inference]

cellular response to sterol [inference]

cellular response to cholesterol

cellular response to oxygen-containing compound [inference]

cellular response to sterol [inference]

cellular response to cholesterol

cellular response to alcohol [inference]

cellular response to cholesterol

cellular response to lipoprotein particle stimulus [inference]

cellular response to low-density lipoprotein particle stimulus

localization [inference]

establishment of localization [inference]

transport [inference]

lipid transport [inference]

sterol transport [inference]

cholesterol transport [inference]

reverse cholesterol transport

organic hydroxy compound transport [inference]

sterol transport [inference]

cholesterol transport [inference]

reverse cholesterol transport

biological regulation [inference]

regulation of biological process [inference]

regulation of localization [inference]

regulation of transport [inference]

regulation of lipid transport [inference]

positive regulation of lipid transport [inference]

positive regulation of sterol transport [inference]

positive regulation of cholesterol transport [inference]

positive regulation of cholesterol efflux

regulation of sterol transport [inference]

positive regulation of sterol transport [inference]

positive regulation of cholesterol transport [inference]

positive regulation of cholesterol efflux

regulation of cholesterol transport [inference]

regulation of cholesterol efflux [inference]

positive regulation of cholesterol efflux

positive regulation of cholesterol transport [inference]

positive regulation of cholesterol efflux

regulation of organic acid transport [inference]

regulation of bile acid secretion

regulation of secretion [inference]

regulation of bile acid secretion

positive regulation of transport [inference]

positive regulation of lipid transport [inference]

positive regulation of sterol transport [inference]

positive regulation of cholesterol transport [inference]

positive regulation of cholesterol efflux

regulation of lipid localization [inference]

regulation of lipid transport [inference]

positive regulation of lipid transport [inference]

positive regulation of sterol transport [inference]

positive regulation of cholesterol transport [inference]

positive regulation of cholesterol efflux

regulation of sterol transport [inference]

positive regulation of sterol transport [inference]

positive regulation of cholesterol transport [inference]

positive regulation of cholesterol efflux

regulation of cholesterol transport [inference]

regulation of cholesterol efflux [inference]

positive regulation of cholesterol efflux

positive regulation of cholesterol transport [inference]

positive regulation of cholesterol efflux

negative regulation of lipid localization [inference]

negative regulation of lipid storage [inference]

negative regulation of cholesterol storage

positive regulation of lipid localization [inference]

positive regulation of lipid transport [inference]

positive regulation of sterol transport [inference]

positive regulation of cholesterol transport [inference]

positive regulation of cholesterol efflux

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of lipid metabolic process [inference]

positive regulation of steroid metabolic process [inference]

positive regulation of cholesterol metabolic process

positive regulation of small molecule metabolic process [inference]

positive regulation of cholesterol metabolic process

positive regulation of transport [inference]

positive regulation of lipid transport [inference]

positive regulation of sterol transport [inference]

positive regulation of cholesterol transport [inference]

positive regulation of cholesterol efflux

positive regulation of lipid localization [inference]

positive regulation of lipid transport [inference]

positive regulation of sterol transport [inference]

positive regulation of cholesterol transport [inference]

positive regulation of cholesterol efflux

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of lipid storage [inference]

negative regulation of cholesterol storage

negative regulation of lipid localization [inference]

negative regulation of lipid storage [inference]

negative regulation of cholesterol storage

regulation of cellular process [inference]

regulation of lipid storage [inference]

regulation of cholesterol storage [inference]

negative regulation of cholesterol storage

negative regulation of lipid storage [inference]

negative regulation of cholesterol storage

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

regulation of lipid biosynthetic process [inference]

regulation of steroid biosynthetic process [inference]

regulation of bile acid biosynthetic process

positive regulation of metabolic process [inference]

positive regulation of lipid metabolic process [inference]

positive regulation of steroid metabolic process [inference]

positive regulation of cholesterol metabolic process

positive regulation of small molecule metabolic process [inference]

positive regulation of cholesterol metabolic process

regulation of ketone metabolic process [inference]

regulation of bile acid biosynthetic process

regulation of small molecule metabolic process [inference]

positive regulation of small molecule metabolic process [inference]

positive regulation of cholesterol metabolic process

regulation of bile acid biosynthetic process

regulation of cholesterol metabolic process [inference]

positive regulation of cholesterol metabolic process

regulation of primary metabolic process [inference]

regulation of lipid metabolic process [inference]

regulation of steroid metabolic process [inference]

positive regulation of steroid metabolic process [inference]

positive regulation of cholesterol metabolic process

regulation of steroid biosynthetic process [inference]

regulation of bile acid biosynthetic process

regulation of cholesterol metabolic process [inference]

positive regulation of cholesterol metabolic process

positive regulation of lipid metabolic process [inference]

positive regulation of steroid metabolic process [inference]

positive regulation of cholesterol metabolic process

regulation of lipid biosynthetic process [inference]

regulation of steroid biosynthetic process [inference]

regulation of bile acid biosynthetic process

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of lipid metabolic process [inference]

positive regulation of steroid metabolic process [inference]

positive regulation of cholesterol metabolic process

positive regulation of small molecule metabolic process [inference]

positive regulation of cholesterol metabolic process

negative regulation of cellular process [inference]

negative regulation of lipid storage [inference]

negative regulation of cholesterol storage

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
cytoplasm	ISO	GO_REF
endoplasmic reticulum	ISO	GO_REF
endoplasmic reticulum	IDA	PMID
endoplasmic reticulum	IBA	GO_REF
endoplasmic reticulum lumen	ISS	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cytoplasm

membrane-enclosed lumen [inference]

organelle lumen [inference]

intracellular organelle lumen [inference]

endoplasmic reticulum lumen

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

membraneless organelle [inference]

intracellular membraneless organelle [inference]

lipid droplet

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

intracellular membraneless organelle [inference]

lipid droplet

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
sterol ester esterase activity	ISO	GO_REF
all-trans-retinyl-palmitate hydrolase, all-trans-retinol forming activity	ISS	GO_REF
all-trans-retinyl-palmitate hydrolase, all-trans-retinol forming activity	ISO	GO_REF
all-trans-retinyl-palmitate hydrolase, all-trans-retinol forming activity	IEA	GO_REF
retinyl-palmitate esterase activity	ISO	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on ester bonds [inference]

lipase activity [inference]

sterol ester esterase activity

carboxylic ester hydrolase activity

sterol ester esterase activity

retinyl-palmitate esterase activity

all-trans-retinyl-palmitate hydrolase, all-trans-retinol forming activity

carboxylesterase activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MCLSALILVSLAAFTAGAGHPSSPPMVDTVQGKVLGKYISLEGFTQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSSVKNATSYPPMCFQDPVTGQIVNDLLTNRKEKIPLQFSEDCLYLNIYTPADLTKSDRLPVMVWIHGGGLVLGGASTYDGLVLSTHENVVVVVIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALHWVQDNIAKFGGDPGSVTIFGESAGGESVSVLVLSPLAKNLFQRAISESGVALTAGLVKKNTRPLAEKIAVISGCKNTTSAAMVHCLRQKTEEELLGTTLKLNLFKLDLHGDSRQSHPFVPTVLDGVLLPKMPEEILAEKNFNTVPYIVGINKQEFGWILPTMMNYPPSDVKLDQMTAMSLLKKSSFLLNLPEDAIAVAIEKYLRDKDYTGRNKDQLLELIGDVVFGVPSVIVSRGHRDAGAPTYMYEFQYSPSFSSEMKPDTVVGDHGDEIYSVFGAPILRGGTSEEEINLSKMMMKFWANFARNGNPNGQGLPHWPEYDQKEGYLQIGATTQQAQKLKEKEVAFWTELLAKKQLPTEHTEL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	Description	Source
80	N-linked (GlcNAc...) asparagine	UniProt
276	N-linked (GlcNAc...) asparagine	GlycoProtDB UniProt
490	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements