GlyCosmos Portal

Submissions

ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2

Summary

UniProt ID: Q64277
Gene Symbol: Bp-3 Bp3 Bst1 Ly65
Gene ID: 12182
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0005623
PubChem: Q64277
RaftProt: Q64277
Re-Glyco: Q64277

Annotation

Keyword: Cell membrane Direct protein sequencing Disulfide bond GPI-anchor Hydrolase NAD Reference proteome Signal Transferase

Gene Ontology (GO)

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
regulation of cell-matrix adhesion	ISO	GO_REF
positive regulation of cell population proliferation	ISO	GO_REF
positive regulation of B cell proliferation
regulation of actin cytoskeleton organization	ISO	GO_REF
regulation of inflammatory response	ISO	GO_REF

GO Hierarchy

biological process

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of B cell proliferation

positive regulation of B cell activation [inference]

positive regulation of B cell proliferation

regulation of leukocyte migration [inference]

regulation of leukocyte chemotaxis [inference]

regulation of granulocyte chemotaxis [inference]

regulation of neutrophil chemotaxis

regulation of neutrophil migration [inference]

regulation of neutrophil chemotaxis

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of B cell proliferation

positive regulation of B cell activation [inference]

positive regulation of B cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of B cell proliferation [inference]

positive regulation of B cell proliferation

positive regulation of lymphocyte proliferation [inference]

positive regulation of B cell proliferation

regulation of B cell activation [inference]

regulation of B cell proliferation [inference]

positive regulation of B cell proliferation

positive regulation of B cell activation [inference]

positive regulation of B cell proliferation

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of B cell proliferation

positive regulation of B cell activation [inference]

positive regulation of B cell proliferation

regulation of signaling [inference]

regulation of signal transduction [inference]

regulation of intracellular signal transduction [inference]

regulation of calcium-mediated signaling

regulation of locomotion [inference]

regulation of chemotaxis [inference]

regulation of leukocyte chemotaxis [inference]

regulation of granulocyte chemotaxis [inference]

regulation of neutrophil chemotaxis

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of leukocyte migration [inference]

regulation of leukocyte chemotaxis [inference]

regulation of granulocyte chemotaxis [inference]

regulation of neutrophil chemotaxis

regulation of neutrophil migration [inference]

regulation of neutrophil chemotaxis

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of B cell proliferation

positive regulation of B cell activation [inference]

positive regulation of B cell proliferation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of leukocyte proliferation [inference]

positive regulation of mononuclear cell proliferation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of B cell proliferation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of B cell proliferation

positive regulation of B cell activation [inference]

positive regulation of B cell proliferation

positive regulation of multicellular organismal process [inference]

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of B cell proliferation

positive regulation of B cell activation [inference]

positive regulation of B cell proliferation

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

regulation of intracellular signal transduction [inference]

regulation of calcium-mediated signaling

regulation of response to external stimulus [inference]

regulation of inflammatory response

regulation of chemotaxis [inference]

regulation of leukocyte chemotaxis [inference]

regulation of granulocyte chemotaxis [inference]

regulation of neutrophil chemotaxis

regulation of response to stress [inference]

regulation of defense response [inference]

regulation of inflammatory response

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of intracellular signal transduction [inference]

regulation of calcium-mediated signaling

regulation of cell adhesion [inference]

regulation of cell-substrate adhesion [inference]

regulation of cell-matrix adhesion

regulation of actin filament-based process [inference]

regulation of actin cytoskeleton organization

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

positive regulation of leukocyte proliferation [inference]

positive regulation of mononuclear cell proliferation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of B cell proliferation

regulation of leukocyte proliferation [inference]

regulation of mononuclear cell proliferation [inference]

positive regulation of mononuclear cell proliferation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of B cell proliferation

regulation of lymphocyte proliferation [inference]

regulation of B cell proliferation [inference]

positive regulation of B cell proliferation

positive regulation of lymphocyte proliferation [inference]

positive regulation of B cell proliferation

positive regulation of leukocyte proliferation [inference]

positive regulation of mononuclear cell proliferation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of B cell proliferation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of leukocyte proliferation [inference]

positive regulation of mononuclear cell proliferation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of B cell proliferation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of B cell proliferation

positive regulation of B cell activation [inference]

positive regulation of B cell proliferation

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of B cell proliferation

positive regulation of B cell activation [inference]

positive regulation of B cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of B cell proliferation [inference]

positive regulation of B cell proliferation

positive regulation of lymphocyte proliferation [inference]

positive regulation of B cell proliferation

regulation of B cell activation [inference]

regulation of B cell proliferation [inference]

positive regulation of B cell proliferation

positive regulation of B cell activation [inference]

positive regulation of B cell proliferation

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of B cell proliferation

positive regulation of B cell activation [inference]

positive regulation of B cell proliferation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of B cell proliferation

positive regulation of B cell activation [inference]

positive regulation of B cell proliferation

regulation of cellular component organization [inference]

regulation of organelle organization [inference]

regulation of cytoskeleton organization [inference]

regulation of actin cytoskeleton organization

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of leukocyte migration [inference]

regulation of leukocyte chemotaxis [inference]

regulation of granulocyte chemotaxis [inference]

regulation of neutrophil chemotaxis

regulation of neutrophil migration [inference]

regulation of neutrophil chemotaxis

regulation of multicellular organismal process [inference]

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of B cell proliferation

positive regulation of B cell activation [inference]

positive regulation of B cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of B cell proliferation [inference]

positive regulation of B cell proliferation

positive regulation of lymphocyte proliferation [inference]

positive regulation of B cell proliferation

regulation of B cell activation [inference]

regulation of B cell proliferation [inference]

positive regulation of B cell proliferation

positive regulation of B cell activation [inference]

positive regulation of B cell proliferation

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of B cell proliferation

positive regulation of B cell activation [inference]

positive regulation of B cell proliferation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of B cell proliferation

positive regulation of B cell activation [inference]

positive regulation of B cell proliferation

positive regulation of multicellular organismal process [inference]

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of B cell proliferation

positive regulation of B cell activation [inference]

positive regulation of B cell proliferation

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
uropod	ISO	GO_REF
plasma membrane	ISS	GO_REF
plasma membrane	ISO	GO_REF
plasma membrane	IBA	GO_REF
plasma membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

cell projection [inference]

plasma membrane bounded cell projection [inference]

uropod

side of membrane

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
transferase activity
phosphorus-oxygen lyase activity
NAD+ nucleosidase activity, cyclic ADP-ribose generating	ISS	GO_REF
NAD+ nucleosidase activity, cyclic ADP-ribose generating	ISO	GO_REF
NAD+ nucleosidase activity, cyclic ADP-ribose generating	IBA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity

hydrolase activity [inference]

hydrolase activity, acting on glycosyl bonds [inference]

hydrolase activity, hydrolyzing N-glycosyl compounds [inference]

NAD+ nucleosidase activity, cyclic ADP-ribose generating

lyase activity [inference]

phosphorus-oxygen lyase activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAVQGGLLSLWLWLWLSLLTVLLGARARWRGEGTTPHLQSIFLGRCAEYTTLLSLGNKNCTAIWEAFKGVLDKDPCSVLPSDYDLFINLSRHPIPRDKSLFWENNHLLVMSYGENTRRLVALCDVLYGKVGDFLSWCRQENASGLDYQSCPTSEDCENNAVDSYWKSASMQYSRDSSGVINVMLNGSEPKGAYPTRGFFADFEIPYLQKDKVTRIEIWVMHDVGGPNVESCGEGSVKILEDRLEALGFQHSCINDYRPVKFLMCVDHSTHPDCIMNSASASMRRESASLHAIGDASLLISLLVALASSSQA

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	Source
59	N-linked (GlcNAc...) asparagine	GlycoProtDB UniProt
88	N-linked (GlcNAc...) asparagine	UniProt
141	N-linked (GlcNAc...) asparagine	UniProt
185	N-linked (GlcNAc...) asparagine	GlycoProtDB UniProt