GlyCosmos Portal

Submissions

Left-right determination factor 1

Summary

UniProt ID: Q64280
Gene Symbol: Lefty1 Ebaf Lefty Stra3 Tgfb4
Gene ID: 13590
Organism: Mus musculus (house mouse)

External Links

Re-Glyco: Q64280

Annotation

Keyword: Cytokine Developmental protein Disulfide bond Glycoprotein Growth factor Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
negative regulation of transcription by RNA polymerase II	IDA	PMID
heart morphogenesis	IMP	PMID
determination of left/right symmetry	IDA	PMID
negative regulation of cell population proliferation	IGI	PMID
anterior/posterior axis specification	IGI	PMID

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein serine/threonine kinase signaling pathway [inference]

transforming growth factor beta receptor superfamily signaling pathway [inference]

BMP signaling pathway

cell motility [inference]

cell migration [inference]

ameboidal-type cell migration [inference]

cell migration involved in gastrulation

multicellular organismal process [inference]

pattern specification process [inference]

axis specification [inference]

anterior/posterior axis specification

specification of symmetry [inference]

determination of bilateral symmetry [inference]

determination of left/right symmetry

developmental process [inference]

anatomical structure morphogenesis [inference]

animal organ morphogenesis [inference]

heart morphogenesis

response to stimulus [inference]

response to chemical [inference]

response to lipid [inference]

response to retinoic acid

response to oxygen-containing compound [inference]

response to retinoic acid

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of activin receptor signaling pathway [inference]

negative regulation of nodal signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of activin receptor signaling pathway [inference]

negative regulation of activin receptor signaling pathway [inference]

negative regulation of nodal signaling pathway

regulation of nodal signaling pathway [inference]

negative regulation of nodal signaling pathway

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of activin receptor signaling pathway [inference]

negative regulation of nodal signaling pathway

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of activin receptor signaling pathway [inference]

negative regulation of nodal signaling pathway

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of activin receptor signaling pathway [inference]

negative regulation of nodal signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell population proliferation

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of activin receptor signaling pathway [inference]

negative regulation of nodal signaling pathway

negative regulation of cellular component organization [inference]

negative regulation of protein-containing complex assembly [inference]

negative regulation of nodal receptor complex assembly

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of activin receptor signaling pathway [inference]

negative regulation of nodal signaling pathway

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of activin receptor signaling pathway [inference]

negative regulation of nodal signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of activin receptor signaling pathway [inference]

negative regulation of activin receptor signaling pathway [inference]

negative regulation of nodal signaling pathway

regulation of nodal signaling pathway [inference]

negative regulation of nodal signaling pathway

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of activin receptor signaling pathway [inference]

negative regulation of nodal signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of activin receptor signaling pathway [inference]

negative regulation of nodal signaling pathway

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein serine/threonine kinase signaling pathway [inference]

transforming growth factor beta receptor superfamily signaling pathway [inference]

BMP signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of activin receptor signaling pathway [inference]

negative regulation of nodal signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of activin receptor signaling pathway [inference]

negative regulation of activin receptor signaling pathway [inference]

negative regulation of nodal signaling pathway

regulation of nodal signaling pathway [inference]

negative regulation of nodal signaling pathway

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of activin receptor signaling pathway [inference]

negative regulation of nodal signaling pathway

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of activin receptor signaling pathway [inference]

negative regulation of nodal signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of cell population proliferation [inference]

negative regulation of cell population proliferation

regulation of cellular component biogenesis [inference]

regulation of protein-containing complex assembly [inference]

negative regulation of protein-containing complex assembly [inference]

negative regulation of nodal receptor complex assembly

regulation of nodal receptor complex assembly [inference]

negative regulation of nodal receptor complex assembly

negative regulation of cellular process [inference]

negative regulation of cell population proliferation

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of activin receptor signaling pathway [inference]

negative regulation of nodal signaling pathway

negative regulation of cellular component organization [inference]

negative regulation of protein-containing complex assembly [inference]

negative regulation of nodal receptor complex assembly

regulation of cellular component organization [inference]

regulation of protein-containing complex assembly [inference]

negative regulation of protein-containing complex assembly [inference]

negative regulation of nodal receptor complex assembly

regulation of nodal receptor complex assembly [inference]

negative regulation of nodal receptor complex assembly

negative regulation of cellular component organization [inference]

negative regulation of protein-containing complex assembly [inference]

negative regulation of nodal receptor complex assembly

Displaying **all 4** entries
GO Term	Evidence Code	Reference
extracellular region	TAS	Reactome Reactome
extracellular region	IDA	PMID
extracellular region	IEA	GO_REF GO_REF
obsolete extracellular space

GO Hierarchy

cellular component

cellular anatomical structure [inference]

extracellular region

Displaying **all 4** entries
GO Term	Evidence Code	Reference
cytokine activity	IBA	GO_REF
transforming growth factor beta receptor binding	IEA	GO_REF
growth factor activity	IEA	GO_REF
nodal binding	IPI	PMID

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

cytokine receptor binding [inference]

transforming growth factor beta receptor binding

nodal binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MPFLWLCWALWALSLVSLREALTGEQILGSLLQQLQLDQPPVLDKADVEGMVIPSHVRTQYVALLQHSHASRSRGKRFSQNLREVAGRFLVSETSTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPRTALRRQKRLSPHSARARVTIEWLRFRDDGSNRTALIDSRLVSIHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPGTWSSHKLVRFAAQGTPDGKGQGEPQLELHTLDLKDYGAQGNCDPEAPVTEGTRCCRQEMYLDLQGMKWAENWILEPPGFLTYECVGSCLQLPESLTSRWPFLGPRQCVASEMTSLPMIVSVKEGGRTRPQVVSLPNMRVQTCSCASDGALIPRRLQP

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
158	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Platelet degranulation	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements