GlyCosmos Portal

Submissions

Histone H2B type 2-E

Summary

UniProt ID

Q64524

Gene Symbol

H2bc21
Hist2h2be

Gene ID

[319190]

Organism

Mus musculus (house mouse)

External Links

Re-Glyco: Q64524

Annotation

Keyword: ADP-ribosylation Acetylation Glycoprotein Hydroxylation Isopeptide bond Methylation Nucleosome core Nucleus Phosphoprotein Reference proteome Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
innate immune response in mucosa	ISO	GO_REF
innate immune response in mucosa	IBA	GO_REF
negative regulation of tumor necrosis factor-mediated signaling pathway	ISO	GO_REF
antibacterial humoral response	ISO	GO_REF
antibacterial humoral response	IBA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune response [inference]

organ or tissue specific immune response [inference]

mucosal immune response [inference]

innate immune response in mucosa

humoral immune response [inference]

antimicrobial humoral response [inference]

innate immune response [inference]

innate immune response in mucosa

cellular process [inference]

cell killing [inference]

killing of cells of another organism

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

antimicrobial humoral response [inference]

innate immune response [inference]

innate immune response in mucosa

disruption of anatomical structure in another organism [inference]

disruption of cell in another organism [inference]

killing of cells of another organism

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to bacterium [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

antimicrobial humoral response [inference]

innate immune response [inference]

innate immune response in mucosa

immune response [inference]

organ or tissue specific immune response [inference]

mucosal immune response [inference]

innate immune response in mucosa

humoral immune response [inference]

antimicrobial humoral response [inference]

innate immune response [inference]

innate immune response in mucosa

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

antimicrobial humoral response [inference]

innate immune response [inference]

innate immune response in mucosa

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

antimicrobial humoral response [inference]

innate immune response [inference]

innate immune response in mucosa

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

regulation of cytokine-mediated signaling pathway [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

regulation of tumor necrosis factor-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of response to cytokine stimulus [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

regulation of cytokine-mediated signaling pathway [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

regulation of tumor necrosis factor-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of response to cytokine stimulus [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

regulation of response to cytokine stimulus [inference]

regulation of cytokine-mediated signaling pathway [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

regulation of tumor necrosis factor-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of response to cytokine stimulus [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of cytokine-mediated signaling pathway [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

regulation of tumor necrosis factor-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
nucleosome	ISO	GO_REF
nucleosome	IBA	GO_REF
nucleosome	IEA	GO_REF
obsolete extracellular space
nucleus	ISO	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

protein-DNA complex [inference]

nucleosome

CENP-A containing nucleosome

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
lipopolysaccharide binding	ISO	GO_REF
DNA binding	IBA	GO_REF
DNA binding	IEA	GO_REF
structural constituent of chromatin	ISO	GO_REF
structural constituent of chromatin	IBA	GO_REF

GO Hierarchy

molecular function

structural molecule activity [inference]

structural constituent of chromatin

binding [inference]

nucleic acid binding [inference]

DNA binding

protein binding [inference]

protein dimerization activity [inference]

protein heterodimerization activity

lipid binding [inference]

lipopolysaccharide binding

carbohydrate derivative binding [inference]

lipopolysaccharide binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MPELAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIANEASRLAHYNKRSTITSREIQTSVRLLLPGELAKHAVSEGTKAVTKYTSAK

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
113	O-linked (GlcNAc) serine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying entries **1 - 10** of 20 in total

1

2

Next ›

Last »
Pathway Name	Organism
Cleavage of the damaged purine	Mus musculus
Condensation of Prophase Chromosomes	Mus musculus
DNA Damage/Telomere Stress Induced Senescence	Mus musculus
Deposition of new CENPA-containing nucleosomes at the centromere	Mus musculus
E3 ubiquitin ligases ubiquitinate target proteins	Mus musculus
Estrogen-dependent gene expression	Mus musculus
G2/M DNA damage checkpoint	Mus musculus
HATs acetylate histones	Mus musculus
Inhibition of DNA recombination at telomere	Mus musculus
Interaction of NuRD complexes with transcription factors	Mus musculus