GlyCosmos Portal

Submissions

Taste receptor type 2 member 5

Summary

UniProt ID: Q645Z1
Gene Symbol: TAS2R5
Gene ID
Organism: Gorilla gorilla gorilla (western lowland gorilla)

External Links

Re-Glyco: Q645Z1

Annotation

Keyword: G-protein coupled receptor Glycoprotein Reference proteome Taste Transmembrane helix

Gene Ontology (GO)

Displaying **all 2** entries
GO Term	Evidence Code	Reference
detection of chemical stimulus involved in sensory perception of bitter taste	IBA	GO_REF
detection of chemical stimulus involved in sensory perception of bitter taste	IEA	GO_REF

GO Hierarchy

biological process

response to stimulus [inference]

detection of stimulus [inference]

detection of chemical stimulus [inference]

detection of chemical stimulus involved in sensory perception [inference]

detection of chemical stimulus involved in sensory perception of taste [inference]

detection of chemical stimulus involved in sensory perception of bitter taste

detection of stimulus involved in sensory perception [inference]

detection of chemical stimulus involved in sensory perception [inference]

detection of chemical stimulus involved in sensory perception of taste [inference]

detection of chemical stimulus involved in sensory perception of bitter taste

Displaying **all 3** entries
GO Term	Evidence Code	Reference
plasma membrane	IEA	GO_REF
membrane	IBA	GO_REF
membrane	IEA	GO_REF GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane

plasma membrane

Displaying **all 3** entries
GO Term	Evidence Code	Reference
G protein-coupled receptor activity	IEA	GO_REF
bitter taste receptor activity	IBA	GO_REF
bitter taste receptor activity	IEA	GO_REF GO_REF

GO Hierarchy

molecular function

molecular transducer activity [inference]

signaling receptor activity [inference]

transmembrane signaling receptor activity [inference]

G protein-coupled receptor activity

taste receptor activity [inference]

bitter taste receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MLSAGLGLLMLVAVVEFLIGLIGNGVLVVWSFREWMRKFNWSSYNLIILGLAGCRFLLQWLIILDLSLFPLFQSSRWLRYLSIFWVLVSQASLWFATFLSVFYCKKITTFDRPAYLWLKQRAYNLSLWCLLGYFIINLLLTVQIGLMFYHPPQGNSSIRYPFESWQYLYAFRLNSGSYLPLMVFLVSSGMLIVSLYTHHKKMKVHSAGRRDVRAKAHITALKSLGCFLFLHLVYIMASPFSITSKTYPPDLTSVFIWETLMAAYPSLHSLILIMGIPRVKQTCQKILWKTVCARRCWGP

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites