GlyCosmos Portal

Submissions

2-hydroxyacylsphingosine 1-beta-galactosyltransferase

Summary

UniProt ID

Q64676

Gene Symbol

Cgt
Ugt4
Ugt8
Ugt8a

Gene ID

[22239]

Organism

Mus musculus (house mouse)

External Links

GlycoProtDB

GPDB0005654

GlyConnect

2-hydroxyacylsphingosine 1-beta-galactosyltransferase

GlyGen

Q64676

PubChem

Q64676

Re-Glyco

Q64676

Annotation

Keyword: Endoplasmic reticulum Glycoprotein Glycosyltransferase Reference proteome Signal Sphingolipid metabolism Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
protein localization to paranode region of axon	IMP	PMID
galactosylceramide biosynthetic process	ISS	GO_REF
galactosylceramide biosynthetic process	ISO	GO_REF
galactosylceramide biosynthetic process	IBA	GO_REF
galactosylceramide biosynthetic process	IEA	GO_REF GO_REF

GO Hierarchy

biological process

cellular process [inference]

ensheathment of neurons [inference]

axon ensheathment [inference]

myelination

metabolic process [inference]

biosynthetic process [inference]

lipid biosynthetic process [inference]

glycolipid biosynthetic process

glycosphingolipid biosynthetic process [inference]

galactosylceramide biosynthetic process

galactolipid biosynthetic process [inference]

galactosylceramide biosynthetic process

sphingolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process [inference]

galactosylceramide biosynthetic process

ceramide biosynthetic process [inference]

galactosylceramide biosynthetic process

carbohydrate derivative biosynthetic process [inference]

glycolipid biosynthetic process

glycosphingolipid biosynthetic process [inference]

galactosylceramide biosynthetic process

galactolipid biosynthetic process [inference]

galactosylceramide biosynthetic process

primary metabolic process [inference]

lipid metabolic process [inference]

sphingolipid metabolic process [inference]

ceramide metabolic process [inference]

glycosylceramide metabolic process [inference]

galactosylceramide metabolic process [inference]

galactosylceramide biosynthetic process

ceramide biosynthetic process [inference]

galactosylceramide biosynthetic process

glycosphingolipid metabolic process [inference]

glycosylceramide metabolic process [inference]

galactosylceramide metabolic process [inference]

galactosylceramide biosynthetic process

glycosphingolipid biosynthetic process [inference]

galactosylceramide biosynthetic process

sphingolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process [inference]

galactosylceramide biosynthetic process

ceramide biosynthetic process [inference]

galactosylceramide biosynthetic process

lipid biosynthetic process [inference]

glycolipid biosynthetic process

glycosphingolipid biosynthetic process [inference]

galactosylceramide biosynthetic process

galactolipid biosynthetic process [inference]

galactosylceramide biosynthetic process

sphingolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process [inference]

galactosylceramide biosynthetic process

ceramide biosynthetic process [inference]

galactosylceramide biosynthetic process

liposaccharide metabolic process [inference]

glycolipid metabolic process [inference]

glycosphingolipid metabolic process [inference]

glycosylceramide metabolic process [inference]

galactosylceramide metabolic process [inference]

galactosylceramide biosynthetic process

glycosphingolipid biosynthetic process [inference]

galactosylceramide biosynthetic process

glycolipid biosynthetic process

glycosphingolipid biosynthetic process [inference]

galactosylceramide biosynthetic process

galactolipid biosynthetic process [inference]

galactosylceramide biosynthetic process

galactolipid metabolic process [inference]

galactosylceramide metabolic process [inference]

galactosylceramide biosynthetic process

galactolipid biosynthetic process [inference]

galactosylceramide biosynthetic process

carbohydrate derivative metabolic process [inference]

carbohydrate derivative biosynthetic process [inference]

glycolipid biosynthetic process

glycosphingolipid biosynthetic process [inference]

galactosylceramide biosynthetic process

galactolipid biosynthetic process [inference]

galactosylceramide biosynthetic process

liposaccharide metabolic process [inference]

glycolipid metabolic process [inference]

glycosphingolipid metabolic process [inference]

glycosylceramide metabolic process [inference]

galactosylceramide metabolic process [inference]

galactosylceramide biosynthetic process

glycosphingolipid biosynthetic process [inference]

galactosylceramide biosynthetic process

glycolipid biosynthetic process

glycosphingolipid biosynthetic process [inference]

galactosylceramide biosynthetic process

galactolipid biosynthetic process [inference]

galactosylceramide biosynthetic process

galactolipid metabolic process [inference]

galactosylceramide metabolic process [inference]

galactosylceramide biosynthetic process

galactolipid biosynthetic process [inference]

galactosylceramide biosynthetic process

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

cytoskeleton organization

cellular component assembly [inference]

cellular component assembly involved in morphogenesis [inference]

paranodal junction assembly

cell junction assembly [inference]

cell-cell junction assembly [inference]

paranodal junction assembly

cell projection organization [inference]

cell projection morphogenesis [inference]

plasma membrane bounded cell projection morphogenesis [inference]

neuron projection morphogenesis

cell junction organization [inference]

cell junction assembly [inference]

cell-cell junction assembly [inference]

paranodal junction assembly

cell-cell junction organization [inference]

cell-cell junction assembly [inference]

paranodal junction assembly

developmental process [inference]

anatomical structure morphogenesis [inference]

cell projection morphogenesis [inference]

plasma membrane bounded cell projection morphogenesis [inference]

neuron projection morphogenesis

anatomical structure formation involved in morphogenesis [inference]

cellular component assembly involved in morphogenesis [inference]

paranodal junction assembly

response to stimulus [inference]

response to stress [inference]

response to immobilization stress

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein localization to axon [inference]

protein localization to paranode region of axon

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
endoplasmic reticulum	ISS	GO_REF
endoplasmic reticulum	ISO	GO_REF
endoplasmic reticulum	IBA	GO_REF
endoplasmic reticulum	IEA	GO_REF GO_REF
membrane	ISS	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
N-acylsphingosine galactosyltransferase activity	ISS	GO_REF
N-acylsphingosine galactosyltransferase activity	ISO	GO_REF
N-acylsphingosine galactosyltransferase activity	IBA	GO_REF
N-acylsphingosine galactosyltransferase activity	IEA	GO_REF GO_REF GO_REF
ceramide glucosyltransferase activity	TAS	PMID

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

glycosyltransferase activity [inference]

UDP-glycosyltransferase activity [inference]

UDP-galactosyltransferase activity [inference]

UDP-glucosyltransferase activity [inference]

ceramide glucosyltransferase activity

hexosyltransferase activity [inference]

galactosyltransferase activity [inference]

UDP-galactosyltransferase activity [inference]

glucosyltransferase activity [inference]

UDP-glucosyltransferase activity [inference]

ceramide glucosyltransferase activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MKSYTPYFMLLWSAVGIARAAKIIIVPPIMFESHLYIFKTLASALHERGHHTVLLLSEGRDIAPSNHYSLQRYPGIFNSTTSDAFLQSKMRNIFSGRLTAVELVDILDHYTKNCDMMVGNQALIQGLKKEKFDLLLVDPNDMCGFVIAHLLGVKYAVFSTGLWYPAEVGAPAPLAYVPEFNSLLTDRMNFLERMKNTGVYLISRIGVSFLVLPKYERIMQKYNLLPAKSMYDLVHGSSLWMLCTDVALEFPRPTLPNVVYVGGILTKPASPLPEDLQRWVSGAQEHGFVLVSFGAGVKYLSEDIANKLAGALGRLPQKVIWRFSGTKPKNLGNNTKLIEWLPQNDLLGHSNIRAFLSHGGLNSIFETMYHGVPVVGIPLFGDHYDTMTRVQAKGMGILLEWNTVTEGELYDALVKVINNPSYRQRAQKLSEIHKDQPGHPVNRTTYWIDYILRHDGARHLRSAVHQISFCQYFLLDIAFVLLLGAVLLYFILSYVTKFIYRKIKSLWSKNEHSTVNGHYQNGIRNGKYKGNGRVKHEKKVR

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
78	N-linked (GlcNAc...) asparagine		G41247ZX	GlycoProtDB UniProt GlyGen
333	N-linked (GlcNAc...) asparagine		G13144LI	UniProt GlyGen
442	N-linked (GlcNAc...) asparagine	30899004	G70101JE G80920RR G65092SV G64527OM G50045TK G05724UK G39188ZX G23453IV G06110VR G66538GV G14669DU	GlycoProtDB UniProt GlyGen GlyConnect