GlyCosmos Portal

Submissions

Beta-galactoside alpha-2,6-sialyltransferase 1

Summary

UniProt ID

Q64685

Gene Symbol

Siat1
St6gal1

Gene ID

[20440]

Organism

Mus musculus (house mouse)

External Links

PubChem: Q64685
Re-Glyco: Q64685

Annotation

Keyword: Disulfide bond Glycoprotein Glycosyltransferase Golgi apparatus Phosphoprotein Reference proteome Secreted Signal-anchor Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
N-acetylneuraminate metabolic process	ISS	GO_REF
N-acetylneuraminate metabolic process	ISO	GO_REF
N-acetylneuraminate metabolic process	IEA	GO_REF
obsolete protein N-linked glycosylation via asparagine
positive regulation of mononuclear cell proliferation	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

macromolecule metabolic process [inference]

macromolecule modification [inference]

sialylation

small molecule metabolic process [inference]

organic acid metabolic process [inference]

oxoacid metabolic process [inference]

carboxylic acid metabolic process [inference]

N-acetylneuraminate metabolic process

carbohydrate derivative metabolic process [inference]

amino sugar metabolic process [inference]

N-acetylneuraminate metabolic process

biological regulation [inference]

regulation of biological process [inference]

regulation of locomotion [inference]

negative regulation of locomotion [inference]

negative regulation of chemotaxis

regulation of chemotaxis [inference]

negative regulation of chemotaxis

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of cell population proliferation [inference]

positive regulation of leukocyte proliferation [inference]

positive regulation of mononuclear cell proliferation

negative regulation of biological process [inference]

negative regulation of locomotion [inference]

negative regulation of chemotaxis

negative regulation of cellular process [inference]

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of myeloid cell apoptotic process [inference]

negative regulation of macrophage apoptotic process

negative regulation of leukocyte apoptotic process [inference]

negative regulation of macrophage apoptotic process

negative regulation of response to stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of chemotaxis

regulation of response to stimulus [inference]

regulation of response to external stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of chemotaxis

regulation of chemotaxis [inference]

negative regulation of chemotaxis

negative regulation of response to stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of chemotaxis

regulation of cellular process [inference]

regulation of cell adhesion [inference]

regulation of cell-substrate adhesion [inference]

regulation of substrate adhesion-dependent cell spreading

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation [inference]

positive regulation of leukocyte proliferation [inference]

positive regulation of mononuclear cell proliferation

regulation of leukocyte proliferation [inference]

regulation of mononuclear cell proliferation [inference]

positive regulation of mononuclear cell proliferation

positive regulation of leukocyte proliferation [inference]

positive regulation of mononuclear cell proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

regulation of myeloid cell apoptotic process [inference]

negative regulation of myeloid cell apoptotic process [inference]

negative regulation of macrophage apoptotic process

regulation of macrophage apoptotic process [inference]

negative regulation of macrophage apoptotic process

negative regulation of apoptotic process [inference]

negative regulation of myeloid cell apoptotic process [inference]

negative regulation of macrophage apoptotic process

negative regulation of leukocyte apoptotic process [inference]

negative regulation of macrophage apoptotic process

regulation of leukocyte apoptotic process [inference]

negative regulation of leukocyte apoptotic process [inference]

negative regulation of macrophage apoptotic process

regulation of macrophage apoptotic process [inference]

negative regulation of macrophage apoptotic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of myeloid cell apoptotic process [inference]

negative regulation of macrophage apoptotic process

negative regulation of leukocyte apoptotic process [inference]

negative regulation of macrophage apoptotic process

positive regulation of cellular process [inference]

positive regulation of cell population proliferation [inference]

positive regulation of leukocyte proliferation [inference]

positive regulation of mononuclear cell proliferation

negative regulation of cellular process [inference]

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of myeloid cell apoptotic process [inference]

negative regulation of macrophage apoptotic process

negative regulation of leukocyte apoptotic process [inference]

negative regulation of macrophage apoptotic process

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
Golgi trans cisterna	ISO	GO_REF
Golgi membrane	ISS	GO_REF
Golgi membrane	ISO	GO_REF
Golgi membrane	IEA	GO_REF
extracellular region	ISS	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

extracellular region

membrane [inference]

organelle membrane [inference]

Golgi cisterna membrane

bounding membrane of organelle [inference]

Golgi membrane

organelle subcompartment [inference]

Golgi apparatus subcompartment [inference]

Golgi cisterna [inference]

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

Golgi apparatus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

Golgi apparatus

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
beta-galactoside alpha-2,6-sialyltransferase activity	ISS	GO_REF
beta-galactoside alpha-2,6-sialyltransferase activity	ISO	GO_REF GO_REF
beta-galactoside alpha-2,6-sialyltransferase activity	IDA	PMID
beta-galactoside alpha-2,6-sialyltransferase activity	IMP	PMID
beta-galactoside alpha-2,6-sialyltransferase activity	IBA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

glycosyltransferase activity [inference]

sialyltransferase activity

beta-galactoside alpha-2,6-sialyltransferase activity

binding [inference]

protein binding [inference]

identical protein binding [inference]

protein homodimerization activity

protein dimerization activity [inference]

protein homodimerization activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MIHTNLKRKFSCFVLVFLLFAIICVWKKGSDYEALTLQAKVFQMPKSQEKVAVGPAPQAVFSNSKQDPKEGVQILSYPRVTAKVKPQPSLQVWDKDSTYSKLNPRLLKIWRNYLNMNKYKVSYKGPGPGVKFSVEALRCHLRDHVNVSMIEATDFPFNTTEWEGYLPKENFRTKAGPWHKCAVVSSAGSLKNSQLGREIDNHDAVLRFNGAPTDNFQQDVGTKTTIRLVNSQLVTTEKRFLKDSLYTEGILILWDPSVYHADIPQWYQKPDYNFFETYKSYRRLHPSQPFYILKPQMPWELWDIIQEISPDLIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYHQKFFDSACTMGAYHPLLFEKNMVKHLNEGTDEDIYLFGKATLSGFRNNRC

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
146	N-linked (GlcNAc...) asparagine			UniProt
158	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 3** entries
Pathway Name	Organism
N-Glycan antennae elongation	Mus musculus
Sialic acid metabolism	Mus musculus
Termination of O-glycan biosynthesis	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements