GlyCosmos Portal

Submissions

Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase

Summary

UniProt ID: Q64687
Gene Symbol: St8sia1 Siat8 Siat8a
Gene ID: 20449
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB

GPDB0005655

GlyConnect

Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase

GlyGen

Q64687

Re-Glyco

Q64687

Annotation

Keyword: Disulfide bond Glycoprotein Glycosyltransferase Golgi apparatus Lipid biosynthesis Reference proteome Signal-anchor Sphingolipid metabolism Transmembrane helix

Gene Ontology (GO)

Displaying **all 5** entries
GO Term	Evidence Code	Reference
N-glycan processing	IBA	GO_REF
sphingolipid metabolic process	IEA	GO_REF
positive regulation of cell population proliferation	IDA	PMID
oligosaccharide metabolic process	IBA	GO_REF
cellular response to heat	IDA	PMID

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

N-glycan processing

carbohydrate derivative biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

N-glycan processing

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

N-glycan processing

protein metabolic process [inference]

glycoprotein metabolic process [inference]

glycoprotein biosynthetic process [inference]

N-glycan processing

primary metabolic process [inference]

carbohydrate metabolic process [inference]

oligosaccharide metabolic process

lipid metabolic process [inference]

sphingolipid metabolic process

protein metabolic process [inference]

glycoprotein metabolic process [inference]

glycoprotein biosynthetic process [inference]

N-glycan processing

carbohydrate derivative metabolic process [inference]

glycoprotein metabolic process [inference]

glycoprotein biosynthetic process [inference]

N-glycan processing

carbohydrate derivative biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

N-glycan processing

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to heat

response to stimulus [inference]

response to stress [inference]

response to heat [inference]

cellular response to heat

cellular response to stress [inference]

cellular response to heat

response to abiotic stimulus [inference]

response to temperature stimulus [inference]

response to heat [inference]

cellular response to heat

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to heat

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

regulation of cellular process [inference]

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

Displaying 1 entry
GO Term	Evidence Code	Reference
Golgi membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

bounding membrane of organelle [inference]

Golgi membrane

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity	ISS	GO_REF
alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity	ISO	GO_REF
alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity	EXP	PMID
alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity	IBA	GO_REF
alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity	IEA	GO_REF GO_REF GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

glycosyltransferase activity [inference]

sialyltransferase activity

alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MSPCGRALHTSRGAMAMLARKFPRTRLPVGASALCVVVLCWLYIFPVYRLPNEKEIVQGVLAQRTAWRTNQTSASLFRRQMEDCCDPAHLFAMTKMNSPMGKSLWYDGELLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKMSGCGRQIDEANFVMRCNLPPLSSEYTRDVGSKTQLVTANPSIIRQRFENLLWSRKKFVDNMKIYNHSYIYMPAFSMKTGTEPSLRVYYTLKDVGANQTVLFANPNFLRNIGKFWKSRGIHAKRLSTGLFLVSAALGLCEEVSIYGFWPFSVNMQGDPISHHYYDNVLPFSGYHAMPEEFLQLWYLHKIGALRMQLDPCEEPSPQPTS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
70	N-linked (GlcNAc...) asparagine		G83460ZZ	GlycoProtDB UniProt GlyGen
118	N-linked (GlcNAc...) asparagine			UniProt GlyGen
213	N-linked (GlcNAc...) asparagine			UniProt GlyGen
244	N-linked (GlcNAc...) asparagine	30899004	G80920RR G06110VR	GlycoProtDB UniProt GlyGen GlyConnect