GlyCosmos Portal

Submissions

Endothelial protein C receptor

Summary

UniProt ID: Q64695
Gene Symbol: Epcr Procr
Gene ID: 19124
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0005658
PubChem: Q64695
Re-Glyco: Q64695

Annotation

Keyword: Blood coagulation Disulfide bond Glycoprotein Receptor Reference proteome Signal Transmembrane helix

Gene Ontology (GO)

Displaying **all 5** entries
GO Term	Evidence Code	Reference
blood coagulation
negative regulation of coagulation	ISO	GO_REF
negative regulation of coagulation	TAS	PMID PMID
negative regulation of coagulation	IBA	GO_REF
negative regulation of coagulation	IEA	GO_REF

GO Hierarchy

biological process

multicellular organismal process [inference]

coagulation [inference]

blood coagulation

biological regulation [inference]

regulation of biological process [inference]

negative regulation of biological process [inference]

negative regulation of multicellular organismal process [inference]

negative regulation of coagulation

regulation of multicellular organismal process [inference]

regulation of coagulation [inference]

negative regulation of coagulation

negative regulation of multicellular organismal process [inference]

negative regulation of coagulation

regulation of biological quality [inference]

regulation of body fluid levels [inference]

hemostasis [inference]

blood coagulation

Displaying **all 4** entries
GO Term	Evidence Code	Reference
obsolete extracellular space
centrosome	IDA	PMID
membrane	IEA	GO_REF
perinuclear region of cytoplasm	ISO	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

microtubule organizing center [inference]

centrosome

Displaying 1 entry
GO Term	Evidence Code	Reference
signaling receptor activity	IEA	GO_REF

GO Hierarchy

molecular function

molecular transducer activity [inference]

signaling receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MLTKFLPLLLLLLPGCALCNSDGSQSLHMLQISYFQDNHHVRHQGNASLGKLLTHTLEGPSQNVTILQLQPWQDPESWERTESGLQIYLTQFESLVKLVYRERKENVFFPLTVSCSLGCELPEEEEEGSEPHVFFDVAVNGSAFVSFRPKTAVWVSGSQEPSKAANFTLKQLNAYNRTRYELQEFLQDTCVEFLENHITTQNMKGSQTGRSYTSLVLGILMGCFIIAGVAVGIFMCTSGRRC

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 5** entries
Position	Description	Source
46	N-linked (GlcNAc...) asparagine	UniProt
63	N-linked (GlcNAc...) asparagine	UniProt
140	N-linked (GlcNAc...) asparagine	UniProt
166	N-linked (GlcNAc...) asparagine	GlycoProtDB UniProt
176	N-linked (GlcNAc...) asparagine	GlycoProtDB UniProt