GlyCosmos Portal

Submissions

Artemin

Summary

UniProt ID: Q6AYE8
Gene Symbol: Artn
Gene ID: 362572
Organism: Rattus norvegicus (Norway rat)

External Links

PubChem: Q6AYE8
Re-Glyco: Q6AYE8

Annotation

Keyword: Disulfide bond Glycoprotein Growth factor Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
axon guidance	ISO	GO_REF
peripheral nervous system development	ISO	GO_REF
peripheral nervous system development	IEP	PMID
glial cell-derived neurotrophic factor receptor signaling pathway	ISO	GO_REF
glial cell-derived neurotrophic factor receptor signaling pathway	IBA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

leukocyte migration [inference]

mononuclear cell migration [inference]

lymphocyte migration [inference]

lymphocyte migration into lymphoid organs

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

glial cell-derived neurotrophic factor receptor signaling pathway

cell motility [inference]

cell migration [inference]

leukocyte migration [inference]

mononuclear cell migration [inference]

lymphocyte migration [inference]

lymphocyte migration into lymphoid organs

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cell projection organization [inference]

plasma membrane bounded cell projection organization [inference]

neuron projection development [inference]

neuron projection guidance [inference]

axon guidance

developmental process [inference]

anatomical structure morphogenesis [inference]

tissue morphogenesis [inference]

Peyer's patch morphogenesis

anatomical structure development [inference]

system development [inference]

peripheral nervous system development

biological regulation [inference]

regulation of biological process [inference]

regulation of locomotion [inference]

positive regulation of locomotion [inference]

positive regulation of chemotaxis [inference]

positive regulation of positive chemotaxis [inference]

induction of positive chemotaxis

regulation of chemotaxis [inference]

positive regulation of chemotaxis [inference]

positive regulation of positive chemotaxis [inference]

induction of positive chemotaxis

regulation of positive chemotaxis [inference]

positive regulation of positive chemotaxis [inference]

induction of positive chemotaxis

positive regulation of biological process [inference]

positive regulation of locomotion [inference]

positive regulation of chemotaxis [inference]

positive regulation of positive chemotaxis [inference]

induction of positive chemotaxis

positive regulation of response to stimulus [inference]

positive regulation of response to external stimulus [inference]

positive regulation of chemotaxis [inference]

positive regulation of positive chemotaxis [inference]

induction of positive chemotaxis

regulation of response to stimulus [inference]

regulation of response to external stimulus [inference]

positive regulation of response to external stimulus [inference]

positive regulation of chemotaxis [inference]

positive regulation of positive chemotaxis [inference]

induction of positive chemotaxis

regulation of chemotaxis [inference]

positive regulation of chemotaxis [inference]

positive regulation of positive chemotaxis [inference]

induction of positive chemotaxis

regulation of positive chemotaxis [inference]

positive regulation of positive chemotaxis [inference]

induction of positive chemotaxis

positive regulation of response to stimulus [inference]

positive regulation of response to external stimulus [inference]

positive regulation of chemotaxis [inference]

positive regulation of positive chemotaxis [inference]

induction of positive chemotaxis

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

glial cell-derived neurotrophic factor receptor signaling pathway

Displaying 1 entry
GO Term	Evidence Code	Reference
obsolete extracellular space

GO Hierarchy

cellular component

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
signaling receptor binding	ISO	GO_REF
signaling receptor binding	IEA	GO_REF
growth factor activity	ISS	GO_REF
growth factor activity	ISO	GO_REF
growth factor activity	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding

receptor tyrosine kinase binding

growth factor receptor binding [inference]

glial cell-derived neurotrophic factor receptor binding

enzyme binding [inference]

kinase binding [inference]

protein kinase binding [inference]

protein tyrosine kinase binding [inference]

receptor tyrosine kinase binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

growth factor activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

growth factor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MELGLGEPTALSHCLRPRWQPALWPTLAALALLSSVTEASLDPMSRSPASRDVPSPVLAPPTDYLPGGHTAHLCSERALRPPPQSPQPAPPPPGPALQSPPAALRGARAARAGTRSSRARATDARGCRLRSQLVPVSALGLGHSSDELIRFRFCSGSCRRARSPHDLSLASLLDAGALRSPPGSRPISQPCCRPTRYEAVSFMDVNSTWRTVDHLSATACGCLG

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
206	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
RAF/MAP kinase cascade	Rattus norvegicus
RET signaling	Rattus norvegicus

Disease

Displaying 1 entry
DO ID	Disease Name	Source
DOID:574	peripheral nervous system disease	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements